Difference between revisions of "Os03g0356414"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Evolution)
Line 15: Line 15:
 
===Evolution===
 
===Evolution===
 
Among the analyzed 378 RING finger-type and 76 U-box-type E3 ubiquitin ligase genes in rice, a drought induced C3HC4 RING finger gene (LOC_Os03g24040) was identified.The deduced protein of this gene contains conserved RING finger and zinc finger motifs and has high sequence
 
Among the analyzed 378 RING finger-type and 76 U-box-type E3 ubiquitin ligase genes in rice, a drought induced C3HC4 RING finger gene (LOC_Os03g24040) was identified.The deduced protein of this gene contains conserved RING finger and zinc finger motifs and has high sequence
identity (82%) with SINAT5 in Arabidopsis,which 2002), which was identified as a homolog of ''Drosophila'' SINA.A genome-wide search identified five paralogous SINA proteins of OsDIS1 in the rice genome. The amino acid identity between OsDIS1 and its paralogs is 91% with Os07g46560, 83% with Os02g19140, 83% with Os05g14860, 83% with Os01g13370, and 71% with Os02g03620. Further alignment between rice and Arabidopsis SINA proteins revealed that except for the N terminus, all the SINA members in rice and Arabidopsis had highly conserved sequences, and all contained the conserved RING finger and zinc finger motifs.Phylogenetic analysis showed that each of the following protein pairs belongs to the same clade: SINAT1 and SINAT2, SINAT4 and SINAT5, and OsDIS1 and Os07g46560; this supports the inference of a possible duplication of these genes in both genomes. Based on pairwise distance analysis, OsDIS1 has a minimal distance of 0.0725 with Os0746560 in rice and 0.2624 with SINAT5 in Arabidopsis,suggesting that Os07g46560 is the closest paralog of OsDIS1 in rice and SINAT5 is the closest ortholog of OsDIS1 in Arabidopsis.[[File:Identification and expression analysis of the OsDIS1 gene in rice. A,Protein sequence alignment between OsDIS1, SINAT5 (Arabidopsis), SINA (Drosophila), and SIAH (human)..jpg]].
+
identity (82%) with SINAT5 in Arabidopsis,which 2002), which was identified as a homolog of ''Drosophila'' SINA.A genome-wide search identified five paralogous SINA proteins of OsDIS1 in the rice genome. The amino acid identity between OsDIS1 and its paralogs is 91% with Os07g46560, 83% with Os02g19140, 83% with Os05g14860, 83% with Os01g13370, and 71% with Os02g03620. Further alignment between rice and Arabidopsis SINA proteins revealed that except for the N terminus, all the SINA members in rice and Arabidopsis had highly conserved sequences, and all contained the conserved RING finger and zinc finger motifs.Phylogenetic analysis showed that each of the following protein pairs belongs to the same clade: SINAT1 and SINAT2, SINAT4 and SINAT5, and OsDIS1 and Os07g46560; this supports the inference of a possible duplication of these genes in both genomes. Based on pairwise distance analysis, OsDIS1 has a minimal distance of 0.0725 with Os0746560 in rice and 0.2624 with SINAT5 in Arabidopsis,suggesting that Os07g46560 is the closest paralog of OsDIS1 in rice and SINAT5 is the closest ortholog of OsDIS1 in Arabidopsis.
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 11:05, 24 May 2014

Please input one-sentence summary here.

Annotated Information

Function

1. OsDIS1 (for Oryza sativa drought-induced SINA protein 1), a C3HC4 RING finger E3 ligase, is involved in drought-stress signal transduction in rice (O. sativa). 2. OsDIS1 possessed E3 ubiquitin ligase activity and that the conserved region of the RING finger is required for the activity. 3. Overexpression of OsDIS1 reduce drought tolerance in transgenic rice plants, while RNA interference silencing of OsDIS1 enhance drought tolerance. 4. A large number of drought-responsive genes were induced or suppressed in the OsDIS1 overexpression plants under normal and drought conditions. 5. OsDIS1 plays a negative role in drought stress tolerance through transcriptional regulation of diverse stress-related genes and possibly through posttranslational regulation of OsNek6 in rice.

Expression

OsDIS1, a functional E3 ligase, interacts with an E2 (OsUBCx) and few substrates or partners to negatively regulates drought stress tolerance. Specifically, OsDIS1 interacts with a serine/threonine protein kinase OsNek6 and promotes its degradation via the 26S proteasome dependent pathway. In additional, OsDIS1 interacts with the drought and salt positive regulator OsSKIPa in rice.File:OsDIS1.jpg

Evolution

Among the analyzed 378 RING finger-type and 76 U-box-type E3 ubiquitin ligase genes in rice, a drought induced C3HC4 RING finger gene (LOC_Os03g24040) was identified.The deduced protein of this gene contains conserved RING finger and zinc finger motifs and has high sequence identity (82%) with SINAT5 in Arabidopsis,which 2002), which was identified as a homolog of Drosophila SINA.A genome-wide search identified five paralogous SINA proteins of OsDIS1 in the rice genome. The amino acid identity between OsDIS1 and its paralogs is 91% with Os07g46560, 83% with Os02g19140, 83% with Os05g14860, 83% with Os01g13370, and 71% with Os02g03620. Further alignment between rice and Arabidopsis SINA proteins revealed that except for the N terminus, all the SINA members in rice and Arabidopsis had highly conserved sequences, and all contained the conserved RING finger and zinc finger motifs.Phylogenetic analysis showed that each of the following protein pairs belongs to the same clade: SINAT1 and SINAT2, SINAT4 and SINAT5, and OsDIS1 and Os07g46560; this supports the inference of a possible duplication of these genes in both genomes. Based on pairwise distance analysis, OsDIS1 has a minimal distance of 0.0725 with Os0746560 in rice and 0.2624 with SINAT5 in Arabidopsis,suggesting that Os07g46560 is the closest paralog of OsDIS1 in rice and SINAT5 is the closest ortholog of OsDIS1 in Arabidopsis.

Labs working on this gene

State Laboratory for Biology of Plant Diseases and Insect Pests; Institute of Plant Protection; Chinese Academy of Agricultural Sciences; Beijing, China State Key Laboratory of Plant Genomics; National Center for Plant Gene Research; Institute of Genetics and Developmental Biology; Chinese Academy of Sciences; Beijing, China Hunan Provincial Key Laboratory of Crop Germplasm Innovation and Utilization; Hunan Agricultural University; Changsha Hunan, China; Department of Plant Pathology;Ohio State University; Columbus, OH USA;Department of Applied Plant Sciences Technology, Kangwon National University;Department of Systems Biology, College of Life Science and Biotechnology, Yonsei University,Seoul 120–749,Korea.


References

1. Ning,Yuese and Jantasuriyarat.The SINA E3 ligase OsDIS1 negatively regulates drought response in rice.Plant physiology.2011,157:242--255; 2. Ning, Yuese and Xie.OsDIS1-mediated stress response pathway in rice.Plant Signal Behav.2011,6:1684--1686; 3. Yamada, Yasuyuki and Koyama.Basic helix-loop-helix transcription factors and regulation of alkaloid biosynthesis.Plant Signal Behav.2011,6:1627--1630; 4. Deikman, Jill and Petracek.Drought tolerance through biotechnology: improving translation from the laboratory to farmers’ fields.Current opinion in biotechnology.2012,23:243--250; 5. Lim, Sung Don and Hwang.Comprehensive Analysis of the Rice RING E3 Ligase Family Reveals Their Functional Diversity in Response to Abiotic stress.DNA research.2013,20:299--314; 6. Cho, Seok Keun and Ryu.The Arabidopsis RING E3 ubiquitin ligase AtAIRP2 plays combinatory roles with AtAIRP1 in abscisic acid-mediated drought stress responses.Plant physiology.2011,157:2240--2257

Structured Information

Gene Name

Os03g0356414

Description

Similar to Ubiquitin ligase SINAT5 (EC 6.3.2.-) (Seven in absentia homolog 5). Splice isoform 2

Version

NM_001186491.1 GI:297722112 GeneID:9266295

Length

3760 bp

Definition

Oryza sativa Japonica Group Os03g0356414, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:14184730..14188489

Sequence Coding Region

14185089..14185409,14185874..14186260,14186613..14186810

Expression

GEO Profiles:Os03g0356414

Genome Context

<gbrowseImage1> name=NC_008396:14184730..14188489 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:14184730..14188489 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcctcagttacttatattgatgactccggttctgaggtaattgatcctccaaagactgaggtgctggatgttaccgaacttgctggtgatcctgttccgcattcaccaaaaccaaatgtggtagtttctagcagtgtgcgtgaactgcttgaatgtccagtctgcctgagcgcaatgtatcctcccattcatcagtgctctaatggtcatacattgtgctctggatgcaaaccaagggttcacaatcgctgtccaacttgtaggcatgaactgggtaatattagatgtcttgctctcgagaaggtggctgcgtcgcttgaacttccatgcaagtaccagaacttcgggtgtgtaggcatttatccttactactgcaagctgaagcatgagtcacagtgccaatataggccttatagctgtccatatgctggatctgaatgcacagttgctggtgacattccatacttggtgaatcacttgaaagatgaccacaaggttgacatgcataatggctgcaccttcaaccatcgctatgtcaagtcgaatcctcatgaagttgagaatgccacctggatgcttacggttttcagctgctttggccagtacttctgcctacatttcgaagcatttcagctggggatggcacctgtgtacatcgccttcctgaggttcatgggtgatgacttggaagcaaagaactacagctacagcctggaggtaggaggcactggccgcaaaatgatctggcaaggggttccccggagcatcagagacagccatcggaaggtccgggatagctatgatgggcttatcatccaacggaacatggccttgttcttctctggtggagaaaggaaggagctcaaattgcgggtcactgggagaatttggaaggaacagtga</cdnaseq>

Protein Sequence

<aaseq>MASVTYIDDSGSEVIDPPKTEVLDVTELAGDPVPHSPKPNVVVS SSVRELLECPVCLSAMYPPIHQCSNGHTLCSGCKPRVHNRCPTCRHELGNIRCLALEK VAASLELPCKYQNFGCVGIYPYYCKLKHESQCQYRPYSCPYAGSECTVAGDIPYLVNH LKDDHKVDMHNGCTFNHRYVKSNPHEVENATWMLTVFSCFGQYFCLHFEAFQLGMAPV YIAFLRFMGDDLEAKNYSYSLEVGGTGRKMIWQGVPRSIRDSHRKVRDSYDGLIIQRN MALFFSGGERKELKLRVTGRIWKEQ</aaseq>

Gene Sequence

<dnaseqindica>3081..3401#2230..2616#1680..1877#aaaaaacgcgagaagagagagagagaagcttttaattcgaattctctctctcatcacggcttcttctgcttctccttctcctcccccctcatccctcctccgccggtagccgccggccgggagcgagcagcgagcgagaccggagcccgccggagccggtctcgctcccccctcctcccttgttcgcgccacccccgaggtacatcccgccgatctctctctttctctctctcgttggtctgctctgtgattttttttttttttgccaaggctgttctttatttggcacagagattgttttttttttccttctttgcgggtgtccggttcgagtccacggggtttgactctgccggaaatggttcgaatgcggcggccggagggcggaggaggggttttggggggcgttcttggtgggttggtttgcgccgagtctttgttaatttgttagggttcttgatctgatgcggcttctcgttgccgggatgcgcttgcctcatggctgaattcaaacaggccggtctctctctccctccctctctcccgtcagccgtgtgctttgaccgagtaagtttttgaacttcgattggttgagctgggggttcttgactttttcttactccacgaatgttcctttttgcacaatggggctactaatgaatggaaagctagagatggtgtgcctaatggtgatgtgccgtcattgtgttagctcggatttgtactgcgaatttgcgagctcacatgctcagctgatgatgtgttgatccagggagtatatataattggttggtagagtacttgctagattgtgctcacgggtctcatttcaaagttcagtatgaaatcttggttgtaaagtagtactagtgttttgttaatcgttagggagtacttctcctgcatttttcttaattttttccctttaaaaactgtaggtggatttgttattagtaaagctgatttgtgccaaatagaaattctgttttatccgcagtaaggtactgtaaacagtacttgcaggcactagggtttattggcaaggttttctatgttacattttaataaatgccacctttttcttcgtcaaaagaagccacggttataaagaaaaagtgaagcattaattgatgtaaatgcacgaactacaaatttccacaaatataaaccttttaataaaatccacaaatgaaagaaaaatgcagttcacacaccaatctctttctcaaaatttacacttttcttataacaggtatgctaaattttcttaatacaaagcatatacaaaacatcacaagcactatagacattcatgacatatctgttgcataggacaatatgcagtatgaagacctggctggtcaaaacttccgatgcacatgtgaggccctatccatgtgctttcttgatttctgctcctttatggccctatctccttcaaagcccttaaacacttcaacagtgtccaatcatactatgagactgtatggatatgggcatatggctatacttttgatgaggcaatgattttttttgttaataatagtgttaataggaagtgttgaattggttttttaaaaggaagtatttaagcattgaatttgtcatttattttgactcactaataacacagatagttctctttcctagcaggaccccttacaatatctagtgtatttatggcctcagttacttatattgatgactccggttctgaggtaattgatcctccaaagactgaggtgctggatgttaccgaacttgctggtgatcctgttccgcattcaccaaaaccaaatgtggtagtttctagcagtgtgcgtgaactgcttgaatgtccagtctgcctgagcgcaatgtatcctcccattcatcaggtgcacatataccacttattgaatcttttttgcacttaaaaaggatattttcttgtatggaagtcacttgggaaacaaaatgcgtgtttcatttaattgcattgcttttactatcttgaatcctgctatcatatttgtagtctggcctgatctatttgaacttatctagatgatttcctggtttaaaacggtcgttctgagctgctttttcacatatgttctgttccactaccaaattgttacccatgtatttaagcaccaaaaaagaagttagctaagatagtatgtacaatatgcacattgttgtactatgttgtaagttgtaaccccaactctttttctgctaatgcagtgctctaatggtcatacattgtgctctggatgcaaaccaagggttcacaatcgctgtccaacttgtaggcatgaactgggtaatattagatgtcttgctctcgagaaggtggctgcgtcgcttgaacttccatgcaagtaccagaacttcgggtgtgtaggcatttatccttactactgcaagctgaagcatgagtcacagtgccaatataggccttatagctgtccatatgctggatctgaatgcacagttgctggtgacattccatacttggtgaatcacttgaaagatgaccacaaggttgacatgcataatggctgcaccttcaaccatcgctatgtcaagtcgaatcctcatgaagttgagaatgccacctggatgcttacggtatcccctcgttaactccaccatgttagttattgtgaagtatatcactgatgtttacttatgcaaagattggttcacttgtctgctaagatagtccatatttctgtactgagttttatgagcctttctgtaaaaataaacattggttcacttgtacagtatgattgcactctgtacttttcatgtcaactgaggatgctgatcatgcagcatagttattggtctaaaataatctctcacctatgaagaaactatgcatcagaatatccatctgcttccatttccaaaaaaaaaaaaaaaaactttgtctgctttacagcacaataatagcatttggacagggctcttgatctgcaaccttttcttgctgctttctaagtgcaatataaaattaagaatttccttctaatctgttcttttccattgaacaaaatggactaagtaactataatgcttccatctaggttttcagctgctttggccagtacttctgcctacatttcgaagcatttcagctggggatggcacctgtgtacatcgccttcctgaggttcatgggtgatgacttggaagcaaagaactacagctacagcctggaggtaggaggcactggccgcaaaatgatctggcaaggggttccccggagcatcagagacagccatcggaaggtccgggatagctatgatgggcttatcatccaacggaacatggccttgttcttctctggtggagaaaggaaggagctcaaattgcgggtcactgggagaatttggaaggaacagtgaaaataaaatgtgaaatgatctgttcatcgttcttaacccttgcatgaacctatgtatcatcacagtgcgagaattatagccattcataggcagtgactctaaaatgaagacttgtaatgttattagcttgttttagctaccatcttctgttagattggtgcctgtggatgactagatgacagtcatgtagaccagagtggcactattgtagaattcctggcaaacttctctttgccttgaactgcttgttgagttgccattctgtggtatagggaaatctaatggcaattcatgagatgaatgtgttgaactctttttcatgtttccagcatatttctagcttctttgttcattctttc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0356414, RefSeq:Os03g0356414