Difference between revisions of "Os08g0114200"

From RiceWiki
Jump to: navigation, search
(Expression)
(References)
Line 21: Line 21:
  
 
==References==
 
==References==
<ref name="ref1"> 1.Zhang, J., et al., Modulating the root elongation by phosphate/nitrogen starvation in an OsGLU3 dependant way in rice. Plant Signal Behav, 2012. 7(9): p. 1144-5.</ref>
+
1 Zhang, J., Xu, L., Wang, F., Deng, M. & Yi, K. Modulating the root elongation by phosphate/nitrogen starvation in an OsGLU3 dependant way in rice. Plant signaling & behavior 7, 1144-1145, doi:10.4161/psb.21334 (2012).
 +
2 Zhou, H. L. et al. OsGLU1, a putative membrane-bound endo-1,4-beta-D-glucanase from rice, affects plant internode elongation. Plant molecular biology 60, 137-151, doi:10.1007/s11103-005-2972-x (2006).
  
 
==Structured Information==
 
==Structured Information==

Revision as of 03:07, 25 May 2014

The rice Os08g0114200 is OsGLU3 which is similar to CEL5=CELLULASE 5 coding a β-1,4-endoglucanase,playing an significant role in root elongation in rice

Annotated Information

Function

The gene OsGLU3 (Os08g0114200), a β-1,4-endoglucanase, can affect the cellulose synthesis for root elongation in rice. And the phosphate starvation induced root elongation in rice depends on the function of OsGLU3 (Os08g0114200). Which was researched that OsGLU3 (Os08g0114200) is also dispensable for nitrogen starvation induced root elongation in rice. The test:The Wild type (WT, SSBM) were grown for 10 d in media without nitrogen and transferred to low nitrogen media (2 mg/L nitrogen) or control media (40 mg/L nitrogen) for another 20d respectively. The nitrogen starvation stress leads to an around 20% increase of primary root elongation in WT as compared with that grown under the control condition, Figure 1A). It showed that nitrogen starvation can lead to an increase of approximately 13% in rice root cell elongation (Fig. 1C and E).It also found that the nitrogen starvation can lead to an approximately 15% increase in root cellulose content (Fig. 1D). It was identified phosphate starvation and the nitrogen starvation stimulate primary root elongation by inducing root cell elongation and activating root mitotic activity.it suggests that nitrogen starvation induced primary root elongation depends on the activity of OsGLU3 (Os08g0114200).An OsGLU3(Os08g0114200) dependant way affect root cell wall cellulose synthesis by modulating root architectureboth in the phosphate or nitrogen starvation in rice.OsGLU3 (Os08g0114200)is a key player in the carbon partitioning system, as loss of function of it can abolish the response.[1]

Mutation

Please input expression information here.

Expression

In the rice genome, endo-1,4-b-D-glucanases form a multiple gene family including OsGLU3 which share high sequence similarity with KOR1.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

1 Zhang, J., Xu, L., Wang, F., Deng, M. & Yi, K. Modulating the root elongation by phosphate/nitrogen starvation in an OsGLU3 dependant way in rice. Plant signaling & behavior 7, 1144-1145, doi:10.4161/psb.21334 (2012). 2 Zhou, H. L. et al. OsGLU1, a putative membrane-bound endo-1,4-beta-D-glucanase from rice, affects plant internode elongation. Plant molecular biology 60, 137-151, doi:10.1007/s11103-005-2972-x (2006).

Structured Information

Gene Name

Os08g0114200

Description

Similar to CEL5=CELLULASE 5 (Fragment)

Version

NM_001067383.1 GI:115474502 GeneID:4344508

Length

1867 bp

Definition

Oryza sativa Japonica Group Os08g0114200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:762215..764081

Sequence Coding Region

762288..762572,762658..763944

Expression

GEO Profiles:Os08g0114200

Genome Context

<gbrowseImage1> name=NC_008401:762215..764081 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:762215..764081 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtgcagttggtcactctcgagccacactctcacttcgccggtgaggcaggcagcaatggagccaaagagcagcagctgcggcggcgccggcattcggctgcggctgctggtcgtgctccacctgctgctcttagttccgagctcggccatggcgttcaactacgccgacgcgctcgccaagtccatcatcttcttcgagggccagcgctccggcaagctcccgcccggcaaccgcatgccgtggcgcgccgactccggcctcaccgacggcgcccagtacaatgtggatttggtgggcgggtactacgacgccggcgacaacgtcaagttcggcctgcccatggcgttctcgacgacgatgctggcgtggagcgtgctcgacttcggcaagttcatgggcgccgagctgcccaacgcccgcgccgccgtgcgctggggcgccgactacctcctcaaggccgccaccgccacgcccggcgcgctctacgtccaggtcgccgaccccaaccaggaccaccgctgctgggagcgccccgaggacatggacacaccccgcagcgtctaccgcgtcaccgccgacaagccgggttccgacgtcgccggcgagacggccgccgcgctcgccgcgtcgtccatggtgttccgccgcgccgacccggcctactccgcgcgcctcctccacgccgcgacgcaggtgttcgacttcgccgaccggcaccgcgggtcgtacagcgactcgctggcgtcgtcggtgtgcccgttctactgctcctactcgggctaccacgacgagctcctgtggggggcgtcgtggctgcaccgcgcgtcgaggaacgcgtcgttcatgtcgtacgtggaggcgaacgggatgcagctcggcgccggggacgacgactactccttcagctgggacgacaagcgggtgggcaccaaggtgctcctcgccaagggcttcctccgcaaccgcctccatggcctcgagctctacaaggcgcactccgacagctacatctgctcgctggtgcccggcacggcgagcttccagtcgcggtacacccccggcggcctcctgtacagggaaggctccagcaacatgcagtacgtgacgacggcgacgttcctgatgctggcgtacgccaagtacctccggtcgagcggcgccaccgcgtcgtgcggcgacggcggcggcggagcgaggggggaggtgtcggcggcggagctggtggcggtggcgaagcggcaggtggactacatcctggggaagaacccggcggggatgtcgtacatggtggggttcgggtgcaggtacccgaggcgggcgcaccaccgcggcgcgtccatgccgtcggtgcgcgcccacccggggcggatctcctgcgacgccggcttcggctacctccactccggcgagcccaacccgaacgtgctcgtcggcgccgtcgtcggcgggccggacagccgcgacgcctttgccgacgaccgcggcaacttcgcgcagtcggagccggccacctacatcaacgcgccgctcgtcggcgcgctcgcctacttcgccggaaccaccaagtag</cdnaseq>

Protein Sequence

<aaseq>MCSWSLSSHTLTSPVRQAAMEPKSSSCGGAGIRLRLLVVLHLLL LVPSSAMAFNYADALAKSIIFFEGQRSGKLPPGNRMPWRADSGLTDGAQYNVDLVGGY YDAGDNVKFGLPMAFSTTMLAWSVLDFGKFMGAELPNARAAVRWGADYLLKAATATPG ALYVQVADPNQDHRCWERPEDMDTPRSVYRVTADKPGSDVAGETAAALAASSMVFRRA DPAYSARLLHAATQVFDFADRHRGSYSDSLASSVCPFYCSYSGYHDELLWGASWLHRA SRNASFMSYVEANGMQLGAGDDDYSFSWDDKRVGTKVLLAKGFLRNRLHGLELYKAHS DSYICSLVPGTASFQSRYTPGGLLYREGSSNMQYVTTATFLMLAYAKYLRSSGATASC GDGGGGARGEVSAAELVAVAKRQVDYILGKNPAGMSYMVGFGCRYPRRAHHRGASMPS VRAHPGRISCDAGFGYLHSGEPNPNVLVGAVVGGPDSRDAFADDRGNFAQSEPATYIN APLVGALAYFAGTTK</aaseq>

Gene Sequence

<dnaseqindica>74..358#444..1730#agcaaattgatatactactccagcaccggccaaattaactaacttaacggccactgcttttcacactatattaatgtgcagttggtcactctcgagccacactctcacttcgccggtgaggcaggcagcaatggagccaaagagcagcagctgcggcggcgccggcattcggctgcggctgctggtcgtgctccacctgctgctcttagttccgagctcggccatggcgttcaactacgccgacgcgctcgccaagtccatcatcttcttcgagggccagcgctccggcaagctcccgcccggcaaccgcatgccgtggcgcgccgactccggcctcaccgacggcgcccagtacaatgtacgtacgccgcctctctctctttccctttcttccttgtctccggcgaggaggagtttgtgattccggcgtgtttgtgtttcaggtggatttggtgggcgggtactacgacgccggcgacaacgtcaagttcggcctgcccatggcgttctcgacgacgatgctggcgtggagcgtgctcgacttcggcaagttcatgggcgccgagctgcccaacgcccgcgccgccgtgcgctggggcgccgactacctcctcaaggccgccaccgccacgcccggcgcgctctacgtccaggtcgccgaccccaaccaggaccaccgctgctgggagcgccccgaggacatggacacaccccgcagcgtctaccgcgtcaccgccgacaagccgggttccgacgtcgccggcgagacggccgccgcgctcgccgcgtcgtccatggtgttccgccgcgccgacccggcctactccgcgcgcctcctccacgccgcgacgcaggtgttcgacttcgccgaccggcaccgcgggtcgtacagcgactcgctggcgtcgtcggtgtgcccgttctactgctcctactcgggctaccacgacgagctcctgtggggggcgtcgtggctgcaccgcgcgtcgaggaacgcgtcgttcatgtcgtacgtggaggcgaacgggatgcagctcggcgccggggacgacgactactccttcagctgggacgacaagcgggtgggcaccaaggtgctcctcgccaagggcttcctccgcaaccgcctccatggcctcgagctctacaaggcgcactccgacagctacatctgctcgctggtgcccggcacggcgagcttccagtcgcggtacacccccggcggcctcctgtacagggaaggctccagcaacatgcagtacgtgacgacggcgacgttcctgatgctggcgtacgccaagtacctccggtcgagcggcgccaccgcgtcgtgcggcgacggcggcggcggagcgaggggggaggtgtcggcggcggagctggtggcggtggcgaagcggcaggtggactacatcctggggaagaacccggcggggatgtcgtacatggtggggttcgggtgcaggtacccgaggcgggcgcaccaccgcggcgcgtccatgccgtcggtgcgcgcccacccggggcggatctcctgcgacgccggcttcggctacctccactccggcgagcccaacccgaacgtgctcgtcggcgccgtcgtcggcgggccggacagccgcgacgcctttgccgacgaccgcggcaacttcgcgcagtcggagccggccacctacatcaacgcgccgctcgtcggcgcgctcgcctacttcgccggaaccaccaagtagccattagtgagagtgtgagtgacgtggcagtgtgggagcgcgaggccagtgagatgagctcccccgccacgctgtatcgttcgttgactttgtcgtgtattcgacgcaacaaacagtatttgcacggagtacgtacg</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0114200, RefSeq:Os08g0114200

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1