Difference between revisions of "Os01g0880800"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(References)
Line 18: Line 18:
  
 
==References==
 
==References==
Please input cited references here.
+
Chang-Jie Jiang,1 Masaki Shimono,1 Satoru Maeda,1 Haruhiko Inoue,1 Masaki Mori,1Morifumi Hasegawa,2 Shoji Sugano,1 and Hiroshi Takatsuji1.Suppression of the Rice Fatty-Acid Desaturase Gene OsSSI2 Enhances Resistance to Blast and Leaf Blight Diseases in Rice.MPMI 2009,22(7): 820–829.
 +
 
 +
Hui-Yuan Ya, Qiu-Fang Chen, Wei-Dong Wang, Guang-Yong Qin, and Zhen Jiao.Pathway Analysis of the Differentially Expressed Genes in Oryza Sativa Exposed to the Implantation of Low-Energy Nitrogen Ion.International Journal of Bioscience, Biochemistry and Bioinformatics, 2011,1( 2 ):89-97.
 +
 
 +
Liebo Shu1, Qiaojun Lou, Chenfei Ma, Wei Ding, Jia Zhou, Jinhong Wu, Fangjun Feng,Xin Lu, Lijun Luo, Guowang Xu� and Hanwei Mei.Genetic, proteomic and metabolic analysis of the regulation of energy storage in rice seedlings in response to drought.Proteomics 2011, 11: 4122–4138.
  
 
==Structured Information==
 
==Structured Information==

Revision as of 04:19, 25 May 2014

Please input one-sentence summary here.

Annotated Information

Function

PathwayId of the Os05g0429900 include osa00061 and osa01040. The function of osa00061 is used in Fatty acid biosynthesis,and the function of osa01040 is used in Biosynthesis of unsaturated fatty acids.Their category are both included lipid metabolism.They both play a importnt role in the lipid metobolism.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Plant Disease Resistance Research Unit, Division of Plant Science, National Institute of Agrobiological Sciences, Kannondai , Tsukuba, 305-8602 Japan; College of Agriculture, Ibaraki University, Ami 300-0393, Japan Shanghai Agrobiological Gene Center, Shanghai, P. R. China CAS Key Laboratory of Separation Science for Analytical Chemistry, Dalian Institute of Chemical Physics, Chinese cademy of Sciences, Dalian, P. R. China National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan, P. R. China

References

Chang-Jie Jiang,1 Masaki Shimono,1 Satoru Maeda,1 Haruhiko Inoue,1 Masaki Mori,1Morifumi Hasegawa,2 Shoji Sugano,1 and Hiroshi Takatsuji1.Suppression of the Rice Fatty-Acid Desaturase Gene OsSSI2 Enhances Resistance to Blast and Leaf Blight Diseases in Rice.MPMI 2009,22(7): 820–829.

Hui-Yuan Ya, Qiu-Fang Chen, Wei-Dong Wang, Guang-Yong Qin, and Zhen Jiao.Pathway Analysis of the Differentially Expressed Genes in Oryza Sativa Exposed to the Implantation of Low-Energy Nitrogen Ion.International Journal of Bioscience, Biochemistry and Bioinformatics, 2011,1( 2 ):89-97.

Liebo Shu1, Qiaojun Lou, Chenfei Ma, Wei Ding, Jia Zhou, Jinhong Wu, Fangjun Feng,Xin Lu, Lijun Luo, Guowang Xu� and Hanwei Mei.Genetic, proteomic and metabolic analysis of the regulation of energy storage in rice seedlings in response to drought.Proteomics 2011, 11: 4122–4138.

Structured Information

Gene Name

Os01g0880800

Description

Similar to Acyl-[acyl-carrier-protein] desaturase, chloroplast precursor (EC 1.14.19.2) (Stearoyl-ACP desaturase)

Version

NM_001051529.1 GI:115441428 GeneID:4324844

Length

1484 bp

Definition

Oryza sativa Japonica Group Os01g0880800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:39980300..39981783

Sequence Coding Region

39980365..39980940,39981027..39981596

Expression

GEO Profiles:Os01g0880800

Genome Context

<gbrowseImage1> name=NC_008394:39980300..39981783 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:39980300..39981783 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcaggtcgtgggaaccgtgcgtgtcagtggctgcggcgcggtggtggcgccctcgcgccggcagtgccgcgtgtccgcggcggtgctgacggccgcggagacggcgacggcgacgcggcgccgcgtgacgcactcgatgccgccggagaaggcggaggtgttccggtcgctggaagggtgggcgaggtcgtcgctgctgccgctgctcaagcccgtggaggagtgctggcagccgacggacttcctgccggactcgtcgtcggagatgttcgagcaccaggtccacgagctccgcgcgcgcgccgcggggctccccgacgagtacttcgtcgtgctggtcggggacatgattaccgaggaggcgctgccgacgtaccagaccatgatcaacacgctcgacggcgtccgcgacgagaccggcgccagcgcctgcccctgggccgtctggacgcgcacctggaccgccgaggagaaccgccacggcgacatcctcggcaagtacatgtacctctccggccgcgtcgacatgcgcatggtcgagaagaccgtccagtacctcatcggctccggcatggatccggggacggagaacaacccgtacctggggttcgtgtacaccagcttccaggagcgcgcgacggccgtgtcgcacgggaacacggcgcgcctcgccagggcgcacggggacgacgtcctggcgcgcacctgcggcaccatcgccgccgacgagaagcggcacgagacggcgtacgggcgcatcgtggagcagctgctgcggctcgacccggacggcgccatgctcgccatcgccgacatgatgcacaagcggatcaccatgcccgcgcacctcatgcacgacggccgcgacatgaacctgttcgaccacttcgccgccgtggcgcagcgcctcaacgtctacaccgcgcgcgactacgccgacatcgtcgagttcctcgtcaagcggtggaagctggagaccctggagactgggctctccggcgagggccggagggcccgggacttcgtgtgcgggctcgcgaagaggatgcggcgggccgcggagcgggctgaggacagggctaagaaggatgagcagaggaaggtcaagttcagctggatctatgatagggaagtgattgtctag</cdnaseq>

Protein Sequence

<aaseq>MQVVGTVRVSGCGAVVAPSRRQCRVSAAVLTAAETATATRRRVT HSMPPEKAEVFRSLEGWARSSLLPLLKPVEECWQPTDFLPDSSSEMFEHQVHELRARA AGLPDEYFVVLVGDMITEEALPTYQTMINTLDGVRDETGASACPWAVWTRTWTAEENR HGDILGKYMYLSGRVDMRMVEKTVQYLIGSGMDPGTENNPYLGFVYTSFQERATAVSH GNTARLARAHGDDVLARTCGTIAADEKRHETAYGRIVEQLLRLDPDGAMLAIADMMHK RITMPAHLMHDGRDMNLFDHFAAVAQRLNVYTARDYADIVEFLVKRWKLETLETGLSG EGRRARDFVCGLAKRMRRAAERAEDRAKKDEQRKVKFSWIYDREVIV</aaseq>

Gene Sequence

<dnaseqindica>66..641#728..1297#agaagaaatcaagaaaccaaccaccaactagctactgtagttgactgacagtgatagtggcagtcatgcaggtcgtgggaaccgtgcgtgtcagtggctgcggcgcggtggtggcgccctcgcgccggcagtgccgcgtgtccgcggcggtgctgacggccgcggagacggcgacggcgacgcggcgccgcgtgacgcactcgatgccgccggagaaggcggaggtgttccggtcgctggaagggtgggcgaggtcgtcgctgctgccgctgctcaagcccgtggaggagtgctggcagccgacggacttcctgccggactcgtcgtcggagatgttcgagcaccaggtccacgagctccgcgcgcgcgccgcggggctccccgacgagtacttcgtcgtgctggtcggggacatgattaccgaggaggcgctgccgacgtaccagaccatgatcaacacgctcgacggcgtccgcgacgagaccggcgccagcgcctgcccctgggccgtctggacgcgcacctggaccgccgaggagaaccgccacggcgacatcctcggcaagtacatgtacctctccggccgcgtcgacatgcgcatggtcgagaagaccgtccagtacctcatcggctccggcatggtacgaatctctcgaaatgttgatgccatttctctgcttggtttcaatcttttttttgcttagcattgttgctgaatccatggcaggatccggggacggagaacaacccgtacctggggttcgtgtacaccagcttccaggagcgcgcgacggccgtgtcgcacgggaacacggcgcgcctcgccagggcgcacggggacgacgtcctggcgcgcacctgcggcaccatcgccgccgacgagaagcggcacgagacggcgtacgggcgcatcgtggagcagctgctgcggctcgacccggacggcgccatgctcgccatcgccgacatgatgcacaagcggatcaccatgcccgcgcacctcatgcacgacggccgcgacatgaacctgttcgaccacttcgccgccgtggcgcagcgcctcaacgtctacaccgcgcgcgactacgccgacatcgtcgagttcctcgtcaagcggtggaagctggagaccctggagactgggctctccggcgagggccggagggcccgggacttcgtgtgcgggctcgcgaagaggatgcggcgggccgcggagcgggctgaggacagggctaagaaggatgagcagaggaaggtcaagttcagctggatctatgatagggaagtgattgtctagtttaacttgtcttggttgaattctgaattcccagtcctagatgatcatgccatttcgttatcatctctgttcttgtgttctctttgcaatgcagtaaattggtaatagttaatggtgctttgatcttggaaatttggcgttgatgtattttctggtatcattagtgaagatagtttggtttcttttc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0880800, RefSeq:Os01g0880800