Difference between revisions of "Os04g0473900"

From RiceWiki
Jump to: navigation, search
(References)
m (Reverted edits by Zhangzhang (talk) to last revision by Mayamei0424)
Line 1: Line 1:
 
Please input one-sentence summary here.
 
Please input one-sentence summary here.
 +
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
This gene is regarded as ''DWA1''.Putative ''DWA1'' plays important roles in drought resistance.The ''DWA1'' is composed of seven exons(Fig.1) The open reading fame (7,176 bp) encodes a protein consisting of 2,391 aa in ''japonica'' rice, Nipponbare, which is one of the 30 megaproteins (>2,300 aa) predicted in the rice genome<ref name="ref1"/>.DWA1,likely to a megaenzyme,has five domains at least. The N terminus of DWA1 is an oxidoreductase-like domain,and closely followed by the AMP-binding domain(A domain)Then,two repeats of a phosphopantetheine-binding subdomain follow the A domain and feature a thiolation domain (T domain).An allene oxide synthase (AOS)-like domain is located between the second and third repeats of the left-handed β-helix (LbH) domain at the C-terminal region<ref name="ref1"/>.
+
This gene is regarded as ''DWA1''.Putative ''DWA1'' plays important roles in drought resistance.The ''DWA1'' is composed of seven exons(Fig.1A) The open reading fame (7,176 bp) encodes a protein consisting of 2,391 aa in ''japonica'' rice, Nipponbare, which is one of the 30 megaproteins (>2,300 aa) predicted in the rice genome<ref name="ref1"/>.<br>
 +
'''(1)'''''DWA1'' encodes a megaenzyme-like protein,harboring at least five domain(as shown in Evolution section),highly conserved in vascular plants.And ''DWA1'' ancestor may be related to the developmental evolution of vascular plants.
 +
'''(2)'''
 +
 
 +
===Mutation===
 +
[[File:图片3.png|right|thumb|200px|Fig.1 Identification of the drought-hypersensitive ''dwa1'' mutant in rice, in which functional complementation of ''dwa1'' restore the drought resistance(from reference<ref name="ref1" />)]]
 +
'''(1)'''There is an insertion of T-DNA in the sixth exon of ''DWA1'' (Fig.1A).<br>
 +
'''(2)'''RT-qPCR analysis of ''DWA1'' in WT and mutant tissues(leaf and panicle) indicate that ''dwa1'' is a loss of-function mutant because of no transcript found in the mutant(Fig.1B).<br>
 +
'''(3)'''During the course of drought treatment, the mutant wilted and exhibited leaf rolling earlier than the WT.After severe drought treatment followed by rewatering, more than 90% of the WT plants survive, whereas the ''dwa1'' mutant plants are almost dead(Fig.1C and D).<br>
 +
'''(4)'''Water loss rate of mutant is faster than WT(Fig.1E).<br>
 +
'''(5)'''DWA1-functional complementation(DWA1-FC)lines which is inserted the full-length genomic fragment of ''DWA1'' into the ''dwa1'' mutant restore drought resistance(Fig.1F and G).<br>
 +
'''(6)'''Plant height at the reproductive stage are also restored in the DWA1-FC lines(Fig.1H).
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
[[File:图片4.png|right|thumb|200px|Fig.2 Expression profiles of ''DWA1'' under normal and stress conditions.(from reference<ref name="ref1" />)]]
 +
[[File:图片5.png|right|thumb|200px|Fig.3 Drought-induced expression of DWA1.(from reference<ref name="ref1" />)]]
 +
'''(1)'''qRCR results show that ''DWA1'' expression level is very low and undetectable at the vegetative stages but is relatively high at the reproductive stages(Fig.2A).<br>
 +
'''(2)'''Using a GUS reporter gene driven by a ''DWA1'' promoter detects that ''DWA1'' expression is mainly in the mature organs, such as in mature leaves (Fig.2B 1-2), axillary bud (Fig.2B3), young panicle (Fig.2B4),spikelet (Fig.2B5), stem (Fig.2B6), young panicle (Fig.2B7), pistil (Fig.2B8), stamen (Fig.2B9), young embryo (Fig.2B10), SEM picture of rice leaf cuticle (Fig.2B11), cross-sections of stem (Fig.2B12) and leaf (Fig.2B13),and semithin sections of leaf (Fig.2B14-15).In addition,SEM observation shows that the GUS staining in leaves is mainly distributed along the silica-cork cell lines in the cuticle.Cross-sections and semithin sections indicate that DWA1 is expressed mainly in vascular tissues and epidermal cell layers.<br>
 +
'''(3)'''What's more,after various phytohormones treatment,''DWA1'' expresses higher,such as abscisic acid, jasmonic acid, indole-3-acetic acid, and
 +
gibberellic acid (Fig.2C).<br>
 +
'''(4)'''Under drought treatment,GUS staining shows that''DWA1'' is induced.For example,in Fig.3B,GUS staining in leaf before (1 and 3) and after (2 and 4) drought stress is shown.<br>
  
 
===Evolution===
 
===Evolution===
At present,homologous sequences with ''DWA1''are all from microorganisms.Nonribosomal peptide synthetase(NRPS),a megaenzyme needed for nonribosomal peptides synthesis in bacteria and filamentous fungi<ref name="ref2"/>,is a major branch of the AMP-binding enzyme superfamily.More importantly,both these homologous sequences and ''DWA1''have an NRPS module, including adenylation domain, followed by a thiolation domain catalyzing the activation and thiolation reaction of an amino acid instead of a carboxyl substrate for acyl-CoA synthetase.These features suggest that DWA1 and its plant homologs may be derived from a prokaryotic NRPS rather than the acyl-CoA synthetase family, which possesses only the A domain<ref name="ref1"/>.
+
[[File:1(DWA1).png|right|thumb|200px|Fig.2 Unrooted phylogenetic tree and domain architecture of DWA1 protein orthologs in vascular plants and microbial relatives(from reference<ref name="ref1" />)]]
 +
At present,DWA1,likely to a megaenzyme,has five domains at least. The N terminus of DWA1 is an oxidoreductase-like domain,and closely followed by the AMP-binding domain(A domain)Then,two repeats of a phosphopantetheine-binding subdomain follow the A domain and feature a thiolation domain (T domain).An allene oxide synthase (AOS)-like domain is located between the second and third repeats of the left-handed β-helix (LbH) domain at the C-terminal region<ref name="ref1"/>(Fig.2).What's more,homologous sequences with ''DWA1''are all from microorganisms.Nonribosomal peptide synthetase(NRPS),a megaenzyme needed for nonribosomal peptides synthesis in bacteria and filamentous fungi<ref name="ref2"/>,is a major branch of the AMP-binding enzyme superfamily.More importantly,both these homologous sequences and ''DWA1'' have an NRPS module, including adenylation domain, followed by a thiolation domain catalyzing the activation and thiolation reaction of an amino acid instead of a carboxyl substrate for acyl-CoA synthetase.These features suggest that DWA1 and its plant homologs may be derived from a prokaryotic NRPS rather than the acyl-CoA synthetase family, which possesses only the A domain<ref name="ref1"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan,China
  
 
==References==
 
==References==
 
<references>
 
<references>
<ref name="ref1">Xiaoyi Zhu, Lizhong Xiong.(2013)Putative megaenzyme DWA1 plays essential roles in drought resistance by regulatingstress-induced wax deposition in rice. PANS 110(44): 17790-17795.</ref>
+
<ref name="ref1">Xiaoyi Zhu, Lizhong Xiong.(2013)Putative megaenzyme DWA1 plays essential roles in drought resistance by regulating stress-induced wax
 +
deposition in rice.PANS 110(44): 17790-17795.</ref>
 
<ref name="ref2">Marahiel MA, Stachelhaus T, Mootz HD.(1997) Modular peptide synthetases involved in nonribosomal peptide synthesis.Chem Rev 97(7):2651–2674.</ref>
 
<ref name="ref2">Marahiel MA, Stachelhaus T, Mootz HD.(1997) Modular peptide synthetases involved in nonribosomal peptide synthesis.Chem Rev 97(7):2651–2674.</ref>
 
</references>
 
</references>

Revision as of 07:08, 25 May 2014

Please input one-sentence summary here.


Annotated Information

Function

This gene is regarded as DWA1.Putative DWA1 plays important roles in drought resistance.The DWA1 is composed of seven exons(Fig.1A) The open reading fame (7,176 bp) encodes a protein consisting of 2,391 aa in japonica rice, Nipponbare, which is one of the 30 megaproteins (>2,300 aa) predicted in the rice genome[1].
(1)DWA1 encodes a megaenzyme-like protein,harboring at least five domain(as shown in Evolution section),highly conserved in vascular plants.And DWA1 ancestor may be related to the developmental evolution of vascular plants. (2)

Mutation

Fig.1 Identification of the drought-hypersensitive dwa1 mutant in rice, in which functional complementation of dwa1 restore the drought resistance(from reference[1])

(1)There is an insertion of T-DNA in the sixth exon of DWA1 (Fig.1A).
(2)RT-qPCR analysis of DWA1 in WT and mutant tissues(leaf and panicle) indicate that dwa1 is a loss of-function mutant because of no transcript found in the mutant(Fig.1B).
(3)During the course of drought treatment, the mutant wilted and exhibited leaf rolling earlier than the WT.After severe drought treatment followed by rewatering, more than 90% of the WT plants survive, whereas the dwa1 mutant plants are almost dead(Fig.1C and D).
(4)Water loss rate of mutant is faster than WT(Fig.1E).
(5)DWA1-functional complementation(DWA1-FC)lines which is inserted the full-length genomic fragment of DWA1 into the dwa1 mutant restore drought resistance(Fig.1F and G).
(6)Plant height at the reproductive stage are also restored in the DWA1-FC lines(Fig.1H).

Expression

Fig.2 Expression profiles of DWA1 under normal and stress conditions.(from reference[1])
Fig.3 Drought-induced expression of DWA1.(from reference[1])

(1)qRCR results show that DWA1 expression level is very low and undetectable at the vegetative stages but is relatively high at the reproductive stages(Fig.2A).
(2)Using a GUS reporter gene driven by a DWA1 promoter detects that DWA1 expression is mainly in the mature organs, such as in mature leaves (Fig.2B 1-2), axillary bud (Fig.2B3), young panicle (Fig.2B4),spikelet (Fig.2B5), stem (Fig.2B6), young panicle (Fig.2B7), pistil (Fig.2B8), stamen (Fig.2B9), young embryo (Fig.2B10), SEM picture of rice leaf cuticle (Fig.2B11), cross-sections of stem (Fig.2B12) and leaf (Fig.2B13),and semithin sections of leaf (Fig.2B14-15).In addition,SEM observation shows that the GUS staining in leaves is mainly distributed along the silica-cork cell lines in the cuticle.Cross-sections and semithin sections indicate that DWA1 is expressed mainly in vascular tissues and epidermal cell layers.
(3)What's more,after various phytohormones treatment,DWA1 expresses higher,such as abscisic acid, jasmonic acid, indole-3-acetic acid, and gibberellic acid (Fig.2C).
(4)Under drought treatment,GUS staining shows thatDWA1 is induced.For example,in Fig.3B,GUS staining in leaf before (1 and 3) and after (2 and 4) drought stress is shown.

Evolution

Fig.2 Unrooted phylogenetic tree and domain architecture of DWA1 protein orthologs in vascular plants and microbial relatives(from reference[1])

At present,DWA1,likely to a megaenzyme,has five domains at least. The N terminus of DWA1 is an oxidoreductase-like domain,and closely followed by the AMP-binding domain(A domain)Then,two repeats of a phosphopantetheine-binding subdomain follow the A domain and feature a thiolation domain (T domain).An allene oxide synthase (AOS)-like domain is located between the second and third repeats of the left-handed β-helix (LbH) domain at the C-terminal region[1](Fig.2).What's more,homologous sequences with DWA1are all from microorganisms.Nonribosomal peptide synthetase(NRPS),a megaenzyme needed for nonribosomal peptides synthesis in bacteria and filamentous fungi[2],is a major branch of the AMP-binding enzyme superfamily.More importantly,both these homologous sequences and DWA1 have an NRPS module, including adenylation domain, followed by a thiolation domain catalyzing the activation and thiolation reaction of an amino acid instead of a carboxyl substrate for acyl-CoA synthetase.These features suggest that DWA1 and its plant homologs may be derived from a prokaryotic NRPS rather than the acyl-CoA synthetase family, which possesses only the A domain[1].

Labs working on this gene

  • National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan,China

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Xiaoyi Zhu, Lizhong Xiong.(2013)Putative megaenzyme DWA1 plays essential roles in drought resistance by regulating stress-induced wax deposition in rice.PANS 110(44): 17790-17795.
  2. Marahiel MA, Stachelhaus T, Mootz HD.(1997) Modular peptide synthetases involved in nonribosomal peptide synthesis.Chem Rev 97(7):2651–2674.

Structured Information

Gene Name

Os04g0473900

Description

Adrenodoxin reductase family protein

Version

NM_001187049.1 GI:297723228 GeneID:9266980

Length

9882 bp

Definition

Oryza sativa Japonica Group Os04g0473900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:24097480..24107361

Sequence Coding Region

24097480..24100068,24100784..24104053,24104151..24104329,24104410..24104769,24104855..24105296
,24105409..24105542,24105689..24105892,24107127..24107361

Expression

GEO Profiles:Os04g0473900

Genome Context

<gbrowseImage1> name=NC_008397:24097480..24107361 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:24097480..24107361 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaggagcggcgcgcgacgtcgccgtcgcggcacagcttttgtcgcgacgcccttggccgccgcgggggggaatctgggggcggcctcgtatatatataccgtagcccgctgaggtcaccgctccaacgccacggcctcaaccgggagtggagactggagaggtggaggtggaggtggaggtgggaagctgccacttggcgccagcgcgccgctgcccacgctcggatcggagaaatggacccaaagagatcaatagatgatcaattttctaagttgcatccaagtttaccagttgatactagaattggcatagtgggagcaggaccaagtggcttatcagcagcctatgcactagctaagctaggttaccgcaatgtaactttgtttgagaaatgccatactgtttcagggatgtgtgagtccattgacattgaagaggaactagggtctgatttcgaagagatggatacacacaaactctccctgattgacagccaaacaggaaatattcgagatcttgaagtagctgaggactatgtatccatggtatctctgacgctaaaattacaggatgaagcaaataagtcaggccgagctggacttcatgctctcagtggattggcatccgacccgacccatgaatttttgaagcaaaatggaataaattcaatgccaaaatctgtagcatatggttacaccgcttcgggctatggttttgttcaagacatgccctatgctttcattcaggagtttactagaacctctatggctggtaaaatccggcgtttcaagcatggttacatgagcatgtgggagagattaagtaaatcattaccatttgaagttttttgtgacacgcaagttctgaatgtcaagcgcaacagttgtggtgcaaatgtaaccatcaagaacaacaatggtgaaaaacaagttttggagttcgacaaaattatactatcaggtgctgttgctttcaagaacagcaaaacatatcgatcctctagtcttactgatggagaaagtgaagtggtggaactaaacaatcttgaaagagaactattcagtaaagtacagactatcgactactatactactgttgttaagatcaatggattcgagcacataccaaagggattttactactttggagaattcatggaggatccaacaacaataggacaccctgtggcaatgcaaagattctttgctgacacaaacattttcttgttttggtcttatggaaattcagcagacatcaagggttcatttgtggctaaatgtgtgactgatgtcgtgagttctatgggaggcaatgttcagaaagtaattttgcaacggcggttcaagtatttccctcatgtcagcagtaaagacatgaaagatggattctatgagaggttggagtcccagttacaaggttttcagaacacttactatgttggaggtttgctagcatttgagcttaccgaaagaaacgcttcgtactccatcatggctgtttgtaagcactttgccattgatggtgagggagaactgactccttatgtcaagagattattccctttgtcccataatagaaatccatcacctcctagagatcttggtgagcttgaaggtgttgaatttcctgaccttccctcccttgatggatatttgcaatactggggaactcataaagtcactgagaagaatgttatctatacttggatcaatgaagaaggaaagctcatgaatcgaagaacctaccaggagcttcatgggaatgcatcttacattgcacaaaaacttttaacaagcacaaaacctgttatcaagcctggtgatagagttctgcttattcacctccctggtttggagtttattgatgcattctttgggtgtattagagcaggagttataccagtccctgtattgccccctgatccaatgcaaagtggtggacaagctcttcttaaagtcgagaacatctctaagatgtgcaatgctgtggctattctatccacctcttcgtaccatgctgctgtacgagcaggttatatcaagaacattgtcactttagcaaagagagttcagaaatgctcagcacagtggcctgacatcccatggattcataccgactcatggataaagaactaccggcgaagctcagacagcttcaactcagacactgttttatttaccaaaccccagccaagtgacttgtgctttctacagttcacttcaggttccactggtgatgccaagggggtgatgataactcatgaaggacttatccacaacgtgaagactatgaaaaagcgttatagaagtacttcaaaaactgtccttgtcagttggcttccacagtatcatgacatgggtcttataggaggtcttttcactgctcttgtaagtggaggaacttctgttctattttcaccaatgatatttatcagaaacccccttctgtggttgcaaacgatcaatgactaccatggaacccatagtgcaggtccaaattttgcatttgaactcgtgataagaaggcttgaggctgagaagaacaaagtatatgacctctcatcaatggtcttcctcatgattgcggcagagccagtaaggcaaaaaactgtcagaaggttcatagagttaactcaaccttttggcctttctgaaggtgtcctcgcacctggatatggtctggctgagaactgtgtctatgttacctgtgccttcggtgaatgcaagccagttttcatagactggcaaggaagagtatgttgtgggtatgttgagcaagatgatacagacactctcatcagaattgttgatcctgactctctaactgagcaccaagaagatggtgttgaaggtgagatatggattagcagtcctagttctggagtaggttattggggcaattcggaaatgagccagagaacttttttcaatcagcttaagaaccaccccaacaagaagttcacaagaaccggtgatttgggacggaccatcgatggtaacctttttattacaggaaggatcaaagatctcatcattgtcgctggtagaaatatttattctgcggatgtagagaagactgtggaaagttcttctgaggtcctccgaccaggctgttgtgctgtggtcggtatcccagaggaagttctggctcagaaaggcatctcaattccagattcttctgatcaggttggacttgttgtgattgcagaggttagagagggtaaggcagtctctaaagaggttgttaacaacatcaaagcacgtgtggtggaggagcatggtgtagctgttgcatctgtgaagcttatcaagcctagaaccatatgcaagacaacatctgggaagatacgaagatttgaatgcatgaggcagtttgttgacaatactcttagtttggctaagggcaaccatgtatctaagaaaaagggtctttttcggtctctgacaacaggaactggcatggagtcaaagaggtccctcttgaggcaaactgttgacctcaccattagccattggcccaaaagccaagttaaaaactccaatgaaataactgagtttctgacacaaatagtgtcagagcacactggcatttcaaaggataaaatttctctaactgacagtctaccttcgtatggttttgattctattgcagtggtacgagcagcccagaagctctcagattttcttggtgttcctgttggggccattgacatctttacagcaagctgcatttcggagcttgcaagcttcttggagaatttggtgcataagtcacaaacacagttggcaccttggcccaaaagcaaagtgaaaaactccaaggtgattatcgagtttctgacaaagattgtatcagatcaaacagggattccaaaggataaaatttctccgatggatagcctaccttcatatggttttgattcaattgcggtggtccaagcagcacagaaactctccgattttctcggtgtacctgttggagccattgacatatttacagctggttgcatttctgagctagctaccttcttggagaatttggcgcataagtcacagtcacagttggcacctggtgcatcttgctatattgaggatgagactcaagtggatcccatggatgccattagtccagaattcagtgttttgggtacgggcatcctgcaactgctggctcttacttatgtctgttttgtgctgctactcccagcatatcttgctagttcgacatacatgagcattttctctacagtcagtctggtcagatcaccattgctgagctatcttagttctttggttatggcacctattgtgtggatcttttatatctcgctcacttctttatcactgtctatcttggggaagtccttcctacagccaaattatgttctgatccctgatgtttcaatatggtcagttgactttgtgaaatggtgggcactaaacaaagcacaagcattagctgcaaagatgctagctgtgcatctaaagggcacaattttcttaaattattggttcaagatgcaaggagctcggattggttcatctgttgtcatcgacacagtagacataaccgatccatccctgttgacggttgcagatggtgcagttcttgcagaaggcgctcttgttcagggccatgaagtctgtaatgaagtgctgagttttaggcctatctggattggctgtgaggcttcgattggtccttatgcggtgcttcagaagggaactgttgtggaagatggagctgttgttccaccattgcagaagactggggctgggaaatcaacacgtcggactagcagaacttctgtaagcataaagaaagaagcagccaaagcaaacatgatacttgaacacctcgttagcatctacgcagttggcatcctgggtgctctgtccggtgcaatcgtctacacactatacactcacttgtccggcaaagcggcttcgcctctgcatttctcctttgcatgcattgctggtgcgttccactggttaccagctgccatcactgcctatgctgttattgtccaggagacacccacaagtgcactgtcatttgctctcttcactgccttcgccgacctgagctatggtgtcatcctcagtattctcaccagtataaccagcagagcccttgctgcaaagcctggaaccaagcagaatggcattgcgagtttgatccaccggcgcataaccatctctgctcatgtcaggtttgccaagatgctatctggaacagaagccttctgcgtgtacctgaggcttctcggagcaaagattggcaggcattgctctatccgagccatcaatccggtggcgaatcctgagctgatcagcgtcggtgatggcgtccatctaggtgacttctgcaatattgttccagggttctactccaaggggggattcaccagtgcagagattaaggtccaggagaacaccgtggttggcagtggcagcttgctcctccctggctgtgtcctccaggagaatgtcatcctcggcgcgctctccgtcgcgccggagaacgctgttctccggcgtggcggcgtctacgtcgggtcacagtctccggccatggtgaagaacaccttgcttgacgaggatgaacggatcgaagagatggatcaggcatacaagaagattgttggcaacctcgcggcgaacttggccatcaccaccatgaacgtcaagtcgaggtacttccaccgcatcggcgtgagcggccgcggcgtcctgaggatgtacgaggagataccgtcgtttccccggcacaagatcttcgcctccggcaagtccttcccggtgatcgtccgccacagcaacagcctgagcgccgacgacgacgcgaggctcgacgcccgcggcgccgcggtgcggatcctctcggacaacgacggcgaggcgcctctcctcgacctcacactcaagagcggcaaggcgttctacgcgcgcaccatcgccgacttcgccacctggctggtctgcggcctgccggcgagggaggagcaggtcaagcgctcgccgcacatccgcgacgccgtctggggctctctccggagcaccgactcgtacaccgtgctccactactactccaacatatgccggctgctgcggttcgacgacggcagggagatgtacgccaagttcaagctccgtcctgctgatccagacgtccccgaggactccggcaaggtggtgccgaggggcatcctgccgccggagaccggcgcgatccccagggacgaggatgacacgcgccctctgctcttcctcgccgacgacttccgccggagagtgggctcaccggacggggtgcgctacgtgttccagctgcagctcagggaggtgcccaccgacgccgccgcccgcgacgtcgccctcgactgcacccggccgtgggacgaggccgagttcccttacatcgacgtcggcgaggtcagcatcggccgcaacctcccgacggaggagacggagaagctcgagttcaacccgttcctccggtgccccgaggtggacgtcatcccggcgacgtcgtgcgcgcagagcgcgtccatcgaccacggccgctcgctggtctacgagatatgccagcgcctgcggaacggcgagccgctgcccgcgtcgtggcgagctttcctggagcagtcggacaccaagatcgacctgtcaggatgcccggtcgctgccgccgcgacacccacaaggtctaacgccggcgacgccacgaaggtgacgctggccaggacgtggtaccaggcgctctgggccacgctgtgccagccgctgctgcaaacgctggtgccgtactctgtcctgggcctcgtcatcttcctcccgctcaggggcctcctcgccgtcgccgcggccacccgcttcccgctctactggctcctcccggcgttctgggccgcgtcgggcgtcgccgccatggccacgtgcgcggcggcgaagtgggcgctggtcggcagcagggtcgacggcgacacggtgcacatctggtcgccggccgtgttcctggacacggtctggcaggccgtgcgcgccgccacggcggagtacttcgccgagctgacgcccgggtcggcgccgttcgcggcgtggatgcgggtgatgggcgcctccgtgtcccccggcgacggcgtgtacgtggactccatgggcgcgctgctgaacccggagatggtgcgcctggagcgcggcgccgccgtcgggcgggacgcgctgctgttcggccacgtgtacgagggcgaggccgggaaggtgaagttcggcgccgtgtccgtcggggaggacgggttcgtcggcagccgcgccgtggccatgcccagcgtcacggtggacgacggcggctgcctcgccgcgctcgggctggccatgaagggggagacggtgaagcacagcatgtaa</cdnaseq>

Protein Sequence

<aaseq>MEERRATSPSRHSFCRDALGRRGGESGGGLVYIYRSPLRSPLQR HGLNREWRLERWRWRWRWEAATWRQRAAAHARIGEMDPKRSIDDQFSKLHPSLPVDTR IGIVGAGPSGLSAAYALAKLGYRNVTLFEKCHTVSGMCESIDIEEELGSDFEEMDTHK LSLIDSQTGNIRDLEVAEDYVSMVSLTLKLQDEANKSGRAGLHALSGLASDPTHEFLK QNGINSMPKSVAYGYTASGYGFVQDMPYAFIQEFTRTSMAGKIRRFKHGYMSMWERLS KSLPFEVFCDTQVLNVKRNSCGANVTIKNNNGEKQVLEFDKIILSGAVAFKNSKTYRS SSLTDGESEVVELNNLERELFSKVQTIDYYTTVVKINGFEHIPKGFYYFGEFMEDPTT IGHPVAMQRFFADTNIFLFWSYGNSADIKGSFVAKCVTDVVSSMGGNVQKVILQRRFK YFPHVSSKDMKDGFYERLESQLQGFQNTYYVGGLLAFELTERNASYSIMAVCKHFAID GEGELTPYVKRLFPLSHNRNPSPPRDLGELEGVEFPDLPSLDGYLQYWGTHKVTEKNV IYTWINEEGKLMNRRTYQELHGNASYIAQKLLTSTKPVIKPGDRVLLIHLPGLEFIDA FFGCIRAGVIPVPVLPPDPMQSGGQALLKVENISKMCNAVAILSTSSYHAAVRAGYIK NIVTLAKRVQKCSAQWPDIPWIHTDSWIKNYRRSSDSFNSDTVLFTKPQPSDLCFLQF TSGSTGDAKGVMITHEGLIHNVKTMKKRYRSTSKTVLVSWLPQYHDMGLIGGLFTALV SGGTSVLFSPMIFIRNPLLWLQTINDYHGTHSAGPNFAFELVIRRLEAEKNKVYDLSS MVFLMIAAEPVRQKTVRRFIELTQPFGLSEGVLAPGYGLAENCVYVTCAFGECKPVFI DWQGRVCCGYVEQDDTDTLIRIVDPDSLTEHQEDGVEGEIWISSPSSGVGYWGNSEMS QRTFFNQLKNHPNKKFTRTGDLGRTIDGNLFITGRIKDLIIVAGRNIYSADVEKTVES SSEVLRPGCCAVVGIPEEVLAQKGISIPDSSDQVGLVVIAEVREGKAVSKEVVNNIKA RVVEEHGVAVASVKLIKPRTICKTTSGKIRRFECMRQFVDNTLSLAKGNHVSKKKGLF RSLTTGTGMESKRSLLRQTVDLTISHWPKSQVKNSNEITEFLTQIVSEHTGISKDKIS LTDSLPSYGFDSIAVVRAAQKLSDFLGVPVGAIDIFTASCISELASFLENLVHKSQTQ LAPWPKSKVKNSKVIIEFLTKIVSDQTGIPKDKISPMDSLPSYGFDSIAVVQAAQKLS DFLGVPVGAIDIFTAGCISELATFLENLAHKSQSQLAPGASCYIEDETQVDPMDAISP EFSVLGTGILQLLALTYVCFVLLLPAYLASSTYMSIFSTVSLVRSPLLSYLSSLVMAP IVWIFYISLTSLSLSILGKSFLQPNYVLIPDVSIWSVDFVKWWALNKAQALAAKMLAV HLKGTIFLNYWFKMQGARIGSSVVIDTVDITDPSLLTVADGAVLAEGALVQGHEVCNE VLSFRPIWIGCEASIGPYAVLQKGTVVEDGAVVPPLQKTGAGKSTRRTSRTSVSIKKE AAKANMILEHLVSIYAVGILGALSGAIVYTLYTHLSGKAASPLHFSFACIAGAFHWLP AAITAYAVIVQETPTSALSFALFTAFADLSYGVILSILTSITSRALAAKPGTKQNGIA SLIHRRITISAHVRFAKMLSGTEAFCVYLRLLGAKIGRHCSIRAINPVANPELISVGD GVHLGDFCNIVPGFYSKGGFTSAEIKVQENTVVGSGSLLLPGCVLQENVILGALSVAP ENAVLRRGGVYVGSQSPAMVKNTLLDEDERIEEMDQAYKKIVGNLAANLAITTMNVKS RYFHRIGVSGRGVLRMYEEIPSFPRHKIFASGKSFPVIVRHSNSLSADDDARLDARGA AVRILSDNDGEAPLLDLTLKSGKAFYARTIADFATWLVCGLPAREEQVKRSPHIRDAV WGSLRSTDSYTVLHYYSNICRLLRFDDGREMYAKFKLRPADPDVPEDSGKVVPRGILP PETGAIPRDEDDTRPLLFLADDFRRRVGSPDGVRYVFQLQLREVPTDAAARDVALDCT RPWDEAEFPYIDVGEVSIGRNLPTEETEKLEFNPFLRCPEVDVIPATSCAQSASIDHG RSLVYEICQRLRNGEPLPASWRAFLEQSDTKIDLSGCPVAAAATPTRSNAGDATKVTL ARTWYQALWATLCQPLLQTLVPYSVLGLVIFLPLRGLLAVAAATRFPLYWLLPAFWAA SGVAAMATCAAAKWALVGSRVDGDTVHIWSPAVFLDTVWQAVRAATAEYFAELTPGSA PFAAWMRVMGASVSPGDGVYVDSMGALLNPEMVRLERGAAVGRDALLFGHVYEGEAGK VKFGAVSVGEDGFVGSRAVAMPSVTVDDGGCLAALGLAMKGETVKHSM</aaseq>

Gene Sequence

<dnaseqindica>7294..9882#3309..6578#3033..3211#2593..2952#2066..2507#1820..1953#1470..1673#1..235#atggaggagcggcgcgcgacgtcgccgtcgcggcacagcttttgtcgcgacgcccttggccgccgcgggggggaatctgggggcggcctcgtatatatataccgtagcccgctgaggtcaccgctccaacgccacggcctcaaccgggagtggagactggagaggtggaggtggaggtggaggtgggaagctgccacttggcgccagcgcgccgctgcccacgctcggatcggaggtatggattccccttccccactcgctgcgtgatgaaccgatgaaccgtagtacttgatgatatgcctgatttgcttcggcattgtgccgcttctctgttagctgggagtttgtggcgtgtcgtttaactgaagtagagatgtgatgatgatctgaggtgagcgccattttttttttttggctaactctgtttgttctattcagtgaatatgagctctcttttttgtcccctttttatcattctgcttctatgggtcgcggagcgttcttggttggtgcagtgcaactgcaatgtcagtatgcatgccatagtaatgtgatggtgggatgtaatgctcctctgcttgctcgagctctttcttggttgtctatctatcttggatgatttgatcaatgtactacttattatctgctgatagtacccggggtccatttgcgctagtattgaacttcttcttctcttataatttgctgaaatcgcgagattatcgcttaggtttatcaatcagaacattatcatgtttatgcttcggttcgttcggtactggcacatgtcaaataagcggaaattctgctactttttcggcttaccatgaatggcacccaacatagcgtggttgttttgtcatgttgaactagtacaaatttttgcaccttaatatttgctttccgtgcatatccaattaacctgcccatcaaacttcttttcagatagctattattggggaaaaatattttcccagcttcttttatagtgactagactgtttatacatgcctgcgtaattgcttccttttgatgagctagtacattatagaccttgattttgttttgatggtacgggttggttattggtgtccatataatgaaattgcaacttgcgaccactccatgatagttacctggtcattccttgttggttaataagctattatttcaaatatgaatgttcatcctacttgtcatattatagacatttgtcacaattcaagtgaggaagaaattctgtaattttctatgggctagttgctgcgttaactacaataatggggctgacatcctgaggttatagtgttcgattaccaagttctaatttattaagaggaatgcaagtcaacatgcatgcctagcccatttacttttaatgagtagtgtaacttctgttgcagaagtactaatgacagctttctatataaatttcacaggttgatttatcaaggacaacaattcgtcagaaatggacccaaagagatcaatagatgatcaattttctaagttgcatccaagtttaccagttgatactagaattggcatagtgggagcaggaccaagtggcttatcagcagcctatgcactagctaagctaggttaccgcaatgtaactttgtttgagaaatgccatactgtttcagggatgtgtgagtccattgacattgaaggtgaggaaactactcagcaaaattatacagtcatcattttgtgcacacttttagttatcagcaacattcgtatgtaggacgaatatatgatttgggaggacaagttatagcagcaaacagtgcccctgttataactcaccttgcagaggaactagggtctgatttcgaagagatggatacacacaaactctccctgattgacagccaaacaggaaatattcgagatcttgaagtagctgaggactatgtatccatggtatctctgacgctaaaattacaggtgagttgttctagaataaaatttaaatttgaggtaactggataataagcatctaattatttataatattctctctatttcttgcatgcgtgttattcaataattcttacaggatgaagcaaataagtcaggccgagctggacttcatgctctcagtggattggcatccgacccgacccatgaatttttgaagcaaaatggaataaattcaatgccaaaatctgtagcatatggttacaccgcttcgggctatggttttgttcaagacatgccctatgctttcattcaggagtttactagaacctctatggctggtaaaatccggcgtttcaagcatggttacatgagcatgtgggagagattaagtaaatcattaccatttgaagttttttgtgacacgcaagttctgaatgtcaagcgcaacagttgtggtgcaaatgtaaccatcaagaacaacaatggtgaaaaacaagttttggagttcgacaaaattatactatcaggtgctgttgctttcaagaacagcaaaacatatcgatcctctagtcttactggtgagcatattttaaattcagtttggctggcattgaagctatagtatttcagttgccttattagtatgtatgatcttttgttcagatggagaaagtgaagtggtggaactaaacaatcttgaaagagaactattcagtaaagtacagactatcgactactatactactgttgttaagatcaatggattcgagcacataccaaagggattttactactttggagaattcatggaggatccaacaacaataggacaccctgtggcaatgcaaagattctttgctgacacaaacattttcttgttttggtcttatggaaattcagcagacatcaagggttcatttgtggctaaatgtgtgactgatgtcgtgagttctatgggaggcaatgttcagaaagtaattttgcaacggcggttcaagtatttccctcatgtcagcagtaaaggtatatatgttaataatatttctcctgttgcaaggtcttcttttttctcgtgataacattggtaatttcctgcattgcagacatgaaagatggattctatgagaggttggagtcccagttacaaggttttcagaacacttactatgttggaggtttgctagcatttgagcttaccgaaagaaacgcttcgtactccatcatggctgtttgtaagcactttgccattgatggtgagggagaactgactccttatgtcaaggtgagcaagaaataatggcgtaatatatctcaattattaattccaccttcatcaaatttcttagagaaattgtgcatatatttttccatacttgcagagattattccctttgtcccataatagaaatccatcacctcctagagatcttggtgagcttgaaggtgttgaatttcctgaccttccctcccttgatggatatttgcaatactggggaactcataaagtcactgagaagaatgttatctatacttggatcaatgaagaaggaaagctcatgaatcgaagaacctaccaggagcttcatgggaatgcatcttacattgcacaaaaacttttaacaagcacaaaacctgttatcaagcctggtgatagagttctgcttattcacctccctggtttggagtttattgatgcattctttgggtgtattagagcaggagttataccagtccctgtattgccccctgatccaatgcaaagtggtggacaagctcttcttaaagtcgagaacatctctaagatgtgcaatgctgtggctattctatccacctcttcgtaccatgctgctgtacgagcaggttatatcaagaacattgtcactttagcaaagagagttcagaaatgctcagcacagtggcctgacatcccatggattcataccgactcatggataaagaactaccggcgaagctcagacagcttcaactcagacactgttttatttaccaaaccccagccaagtgacttgtgctttctacagttcacttcaggttccactggtgatgccaagggggtgatgataactcatgaaggacttatccacaacgtgaagactatgaaaaagcgttatagaagtacttcaaaaactgtccttgtcagttggcttccacagtatcatgacatgggtcttataggaggtcttttcactgctcttgtaagtggaggaacttctgttctattttcaccaatgatatttatcagaaacccccttctgtggttgcaaacgatcaatgactaccatggaacccatagtgcaggtccaaattttgcatttgaactcgtgataagaaggcttgaggctgagaagaacaaagtatatgacctctcatcaatggtcttcctcatgattgcggcagagccagtaaggcaaaaaactgtcagaaggttcatagagttaactcaaccttttggcctttctgaaggtgtcctcgcacctggatatggtctggctgagaactgtgtctatgttacctgtgccttcggtgaatgcaagccagttttcatagactggcaaggaagagtatgttgtgggtatgttgagcaagatgatacagacactctcatcagaattgttgatcctgactctctaactgagcaccaagaagatggtgttgaaggtgagatatggattagcagtcctagttctggagtaggttattggggcaattcggaaatgagccagagaacttttttcaatcagcttaagaaccaccccaacaagaagttcacaagaaccggtgatttgggacggaccatcgatggtaacctttttattacaggaaggatcaaagatctcatcattgtcgctggtagaaatatttattctgcggatgtagagaagactgtggaaagttcttctgaggtcctccgaccaggctgttgtgctgtggtcggtatcccagaggaagttctggctcagaaaggcatctcaattccagattcttctgatcaggttggacttgttgtgattgcagaggttagagagggtaaggcagtctctaaagaggttgttaacaacatcaaagcacgtgtggtggaggagcatggtgtagctgttgcatctgtgaagcttatcaagcctagaaccatatgcaagacaacatctgggaagatacgaagatttgaatgcatgaggcagtttgttgacaatactcttagtttggctaagggcaaccatgtatctaagaaaaagggtctttttcggtctctgacaacaggaactggcatggagtcaaagaggtccctcttgaggcaaactgttgacctcaccattagccattggcccaaaagccaagttaaaaactccaatgaaataactgagtttctgacacaaatagtgtcagagcacactggcatttcaaaggataaaatttctctaactgacagtctaccttcgtatggttttgattctattgcagtggtacgagcagcccagaagctctcagattttcttggtgttcctgttggggccattgacatctttacagcaagctgcatttcggagcttgcaagcttcttggagaatttggtgcataagtcacaaacacagttggcaccttggcccaaaagcaaagtgaaaaactccaaggtgattatcgagtttctgacaaagattgtatcagatcaaacagggattccaaaggataaaatttctccgatggatagcctaccttcatatggttttgattcaattgcggtggtccaagcagcacagaaactctccgattttctcggtgtacctgttggagccattgacatatttacagctggttgcatttctgagctagctaccttcttggagaatttggcgcataagtcacagtcacagttggcacctggtgcatcttgctatattgaggatgagactcaagtggatcccatggatgccattagtccagaattcagtgttttgggtacgggcatcctgcaactgctggctcttacttatgtctgttttgtgctgctactcccagcatatcttgctagttcgacatacatgagcattttctctacagtcagtctggtcagatcaccattgctgagctatcttagttctttggttatggcacctattgtgtggatcttttatatctcgctcacttctttatcactgtctatcttggggaagtccttcctacagccaaattatgttctgatccctgatgtttcaatatggtcagttgactttgtgaaatggtgggcactaaacaaagcacaagcattagctgcaaagatgctagctgtgcatctaaagggcacaattttcttaaattattggttcaagatgcaaggagctcggattggttcatctgttgtcatcgacacagtagacataaccgatccatccctgttgacggttgcagatggtgcagttcttgcagaaggcgctcttgttcagggccatgaagtctgtaatgaagtgctgagttttaggcctatctggattggctgtgaggcttcgattggtccttatgcggtgcttcagaagggaactgttgtggaagatggagctgttgttccaccattgcagaagactggggctgggaaatcaacacgtcggactagcagaacttctgtaagcataaaggtaactaaagtatgtagacttcataatctacttcggtgtaataaaactatgatttgttatggtatacaacgatagtttgttccttcctgaccagaaacgtatagttgattatttctagacattgaatatagtaagctacagacttataattacaccataggccatttgaatttccttgtggtctttaacatggatgaagctgccaccaaagaacttccctacctttttacatttagtgaaaatattttttgagattcaggaagggacatatattttatcagggaaccataagcaaatcatttatgtacaagtggtcaagcagaaaaatcatataaattaaacaagatgaagggtttgtttggattgaagtcaatcttttggcaacttcaatagtattgtatagatatttggtccgataccaaatttttcccacactagtgcaaattctactcttaacaaatttggtagtgccgaaatttaccaatgttttggcacttccagtattttggtaagacaaaaaaatggcttcaaaccaaactagcccaaactcttttctgcatggtgcatagtgtctgcgtgtgtgcattttcattcgacagtggggtatatatctaactgccttcaaagttctcgattgcttctgcagaacatgtttgttcatggccatatttatataatgttattcgaatacaaaccgagtattttttctttgcagaaagaagcagccaaagcaaacatgatacttgaacacctcgttagcatctacgcagttggcatcctgggtgctctgtccggtgcaatcgtctacacactatacactcacttgtccggcaaagcggcttcgcctctgcatttctcctttgcatgcattgctggtgcgttccactggttaccagctgccatcactgcctatgctgttattgtccaggagacacccacaagtgcactgtcatttgctctcttcactgccttcgccgacctgagctatggtgtcatcctcagtattctcaccagtataaccagcagagcccttgctgcaaagcctggaaccaagcagaatggcattgcgagtttgatccaccggcgcataaccatctctgctcatgtcaggtttgccaagatgctatctggaacagaagccttctgcgtgtacctgaggcttctcggagcaaagattggcaggcattgctctatccgagccatcaatccggtggcgaatcctgagctgatcagcgtcggtgatggcgtccatctaggtgacttctgcaatattgttccagggttctactccaaggggggattcaccagtgcagagattaaggtccaggagaacaccgtggttggcagtggcagcttgctcctccctggctgtgtcctccaggagaatgtcatcctcggcgcgctctccgtcgcgccggagaacgctgttctccggcgtggcggcgtctacgtcgggtcacagtctccggccatggtgaagaacaccttgcttgacgaggatgaacggatcgaagagatggatcaggcatacaagaagattgttggcaacctcgcggcgaacttggccatcaccaccatgaacgtcaagtcgaggtacttccaccgcatcggcgtgagcggccgcggcgtcctgaggatgtacgaggagataccgtcgtttccccggcacaagatcttcgcctccggcaagtccttcccggtgatcgtccgccacagcaacagcctgagcgccgacgacgacgcgaggctcgacgcccgcggcgccgcggtgcggatcctctcggacaacgacggcgaggcgcctctcctcgacctcacactcaagagcggcaaggcgttctacgcgcgcaccatcgccgacttcgccacctggctggtctgcggcctgccggcgagggaggagcaggtcaagcgctcgccgcacatccgcgacgccgtctggggctctctccggagcaccgactcgtacaccgtgctccactactactccaacatatgccggctgctgcggttcgacgacggcagggagatgtacgccaagttcaagctccgtcctgctgatccagacgtccccgaggactccggcaaggtggtgccgaggggcatcctgccgccggagaccggcgcgatccccagggacgaggatgacacgcgccctctgctcttcctcgccgacgacttccgccggagagtgggctcaccggacggggtgcgctacgtgttccagctgcagctcagggaggtgcccaccgacgccgccgcccgcgacgtcgccctcgactgcacccggccgtgggacgaggccgagttcccttacatcgacgtcggcgaggtcagcatcggccgcaacctcccgacggaggagacggagaagctcgagttcaacccgttcctccggtgccccgaggtggacgtcatcccggcgacgtcgtgcgcgcagagcgcgtccatcgaccacggccgctcgctggtctacgagatatgccagcgcctgcggaacggcgagccgctgcccgcgtcgtggcgagctttcctggagcagtcggacaccaagatcgacctgtcaggatgcccggtcgctgccgccgcgacacccacaaggtctaacgccggcgacgccacgaaggtgacgctggccaggacgtggtaccaggcgctctgggccacgctgtgccagccgctgctgcaaacgctggtgccgtactctgtcctgggcctcgtcatcttcctcccgctcaggggcctcctcgccgtcgccgcggccacccgcttcccgctctactggctcctcccggcgttctgggccgcgtcgggcgtcgccgccatggccacgtgcgcggcggcgaagtgggcgctggtcggcagcagggtcgacggcgacacggtgcacatctggtcgccggccgtgttcctggacacggtctggcaggccgtgcgcgccgccacggcggagtacttcgccgagctgacgcccgggtcggcgccgttcgcggcgtggatgcgggtgatgggcgcctccgtgtcccccggcgacggcgtgtacgtggactccatgggcgcgctgctgaacccggagatggtgcgcctggagcgcggcgccgccgtcgggcgggacgcgctgctgttcggccacgtgtacgagggcgaggccgggaaggtgaagttcggcgccgtgtccgtcggggaggacgggttcgtcggcagccgcgccgtggccatgcccagcgtcacggtggacgacggcggctgcctcgccgcgctcgggctggccatgaagggggagacggtgaagcacagcatgtaa</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0473900, RefSeq:Os04g0473900