Difference between revisions of "Os08g0535200"
(→References) |
|||
| Line 1: | Line 1: | ||
| − | + | Xa13 is a gene controlling of rice disease resistance genes and the reproductive growth of rice. | |
| − | |||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | Xa13 is a recessive resistance to bacterial leaf blight gene.Through the expression of RNA interference suppression xa13, to enhance the resistance of xa13 mediated, suggests xa13 dominant allele lack of dialogue leaf blight resistance is a must. It is worth noting that from cultivars determined dominant allele identified in Xa13, if inhibition of its expression, the enhancement of strain PX099 resistance at the same time, also can cause rice male sterility (pollen), reduce the seed setting rate. | |
| − | + | ===Localization=== | |
| + | Rice xa13 recessive resistance gene is Os - 8 N3 alleles, Os - 8 N3 element (NODULIN3, N3) root nodules and belongs to one of the members of the family, Xa13 is Located in the chromosome 8. | ||
===Expression=== | ===Expression=== | ||
| − | + | Os - 8 n3 is a pathogen of bacterial leaf blight disease genes, the resistance of recessive alleles can be those who have a class III effect AvrXa7, PthXo2 or PthXo3 pathogen small kind of damage, the effects of child all belong to class members of the family of transcription activation son son (TAL) effect. AvrXa7 PthXo3 can activate the N3 and another member of the family genes Os - 11 N3 expression. Os - 11 n3 insertion mutation or mediated by RNA silence, for those who rely on AvrXa7 and PthXo3 disease specific disease of small kind of loss. Results further indicated that AvrXa7 drive Os - 11 n3 expression, and AvrXa7 can with Os - 11 n3 promoter specific combination of component interactions. | |
===Evolution=== | ===Evolution=== | ||
| − | + | 1.the researches of TAL effect specific combination model | |
| − | + | 2.TAL effect child repetitive structure domain by choice, used to overcome the explicit and implicit two forms of rice bacterial leaf blight resistance | |
| + | 3.Researchers find two proteins:Os-8N3 and Os-11N3 ,they are coding close relatives,and the functions are studied. | ||
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
Revision as of 09:39, 25 May 2014
Xa13 is a gene controlling of rice disease resistance genes and the reproductive growth of rice.
Contents
Annotated Information
Function
Xa13 is a recessive resistance to bacterial leaf blight gene.Through the expression of RNA interference suppression xa13, to enhance the resistance of xa13 mediated, suggests xa13 dominant allele lack of dialogue leaf blight resistance is a must. It is worth noting that from cultivars determined dominant allele identified in Xa13, if inhibition of its expression, the enhancement of strain PX099 resistance at the same time, also can cause rice male sterility (pollen), reduce the seed setting rate.
Localization
Rice xa13 recessive resistance gene is Os - 8 N3 alleles, Os - 8 N3 element (NODULIN3, N3) root nodules and belongs to one of the members of the family, Xa13 is Located in the chromosome 8.
Expression
Os - 8 n3 is a pathogen of bacterial leaf blight disease genes, the resistance of recessive alleles can be those who have a class III effect AvrXa7, PthXo2 or PthXo3 pathogen small kind of damage, the effects of child all belong to class members of the family of transcription activation son son (TAL) effect. AvrXa7 PthXo3 can activate the N3 and another member of the family genes Os - 11 N3 expression. Os - 11 n3 insertion mutation or mediated by RNA silence, for those who rely on AvrXa7 and PthXo3 disease specific disease of small kind of loss. Results further indicated that AvrXa7 drive Os - 11 n3 expression, and AvrXa7 can with Os - 11 n3 promoter specific combination of component interactions.
Evolution
1.the researches of TAL effect specific combination model 2.TAL effect child repetitive structure domain by choice, used to overcome the explicit and implicit two forms of rice bacterial leaf blight resistance 3.Researchers find two proteins:Os-8N3 and Os-11N3 ,they are coding close relatives,and the functions are studied. You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
1. Changyan Li;Jing Wei;Yongjun Lin;Hao Chen
Gene silencing using the recessive rice bacterial blight resistance gene xa13 as a new paradigm in plant breeding Plant Cell Reports, 2012, 31(5): 851-862
2. Ting Yuan;Xianghua Li;Jinghua Xiao;Shiping Wang
Characterization of Xanthomonas oryzae-Responsive cis-Acting Element in the Promoter of Rice Race-Specific Susceptibility Gene Xa13 Molecular Plant, 2011, 4(2): 300-309
3. Ginny Antony;Junhui Zhou;Sheng Huang;Ting Lib;Bo Liu;Frank White;Bing Yang
Rice xa13 Recessive Resistance to Bacterial Blight Is Defeated by Induction of the Disease Susceptibility Gene Os-11N3 The Plant Cell, 2010, 22(11): 3864-3876
4. Meng Yuan;Zhaohui Chu;Xianghua Li;Caiguo Xu;Shiping Wang
The Bacterial Pathogen Xanthomonas oryzae Overcomes Rice Defenses by Regulating Host Copper Redistribution The Plant Cell, 2010, 22(9): 3164-3176
5. Zhaohui Chu;Meng Yuan;Jialing Yao;Xiaojia Ge;Bin Yuan;Caiguo Xu;Xianghua Li;Binying Fu;Zhikang Li;Jeffrey L. Bennetzen;Qifa Zhang and Shiping Wang
Promoter mutations of an essential gene for pollen development result in disease resistance in rice GENES & DEVELOPMENT, 2006, 20(10): 1250-1255
6. Zhaohui Chu;Binying Fu;Hong Yang;Caiguo Xu;Zhikang Li;A. Sanchez;Y. J. Park;J. L. Bennetzen;Qifa Zhang and Shiping Wang
Targeting xa13, a recessive gene for bacterial blight resistance in rice Theoretical and Applied Genetics, 2006, 112(3): 455-461
7. Marella Lalitha Shanti; M. L. C. George; C. M. Vera Cruz; M. A. Bernardo; R. J. Nelson; H. Leung; J. N. Reddy and R. Sridhar
Identification of Resistance Genes Effective Against Rice Bacterial Blight Pathogen in Eastern India Phytopathology, 2001, 85(5): 506-512
8. A. C. Sanchez;L. L. Ilag;D. Yang;D. S. Brar;F. Ausubel;G. S. Khush;M. Yano;T. Sasaki;Z. Li;N. Huang
Genetic and physical mapping of xa13, a recessive bacterial blight resistance gene in rice Theoretical and Applied Genetics, 1999, 98(6-7): 1022-1028
9. G. Zhang;E. R. Angeles;M. L. P. Abenes;G. S. Khush and N. Huang
RAPD and RFLP mapping of the bacterial blight resistance gene xa-13 in rice Theoretical and Applied Genetics, 1996, 93(1-2): 65-70
10. T. OGAWA, Luo LIN, R. E. TABIEN and G. S. KHUSH
A new recessive gene for resistance to bacterial blight of rice Rice Genetics Newsletters, 1987, 4(0): 98-100
Structured Information
| Gene Name |
Os08g0535200 |
|---|---|
| Description |
Similar to MtN3-like protein |
| Version |
NM_001068889.1 GI:115477516 GeneID:4346153 |
| Length |
2843 bp |
| Definition |
Oryza sativa Japonica Group Os08g0535200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 8:26813957..26816799 |
| Sequence Coding Region |
26814378..26814713,26814806..26814925,26815020..26815392,26815491..26815527,26816571..26816628 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008401:26813957..26816799 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008401:26813957..26816799 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcaggaggtttcttgtccatggctaacccggcggtcaccctctccggtgttgcaggaaacatcatctccttcctggtgttccttgcaccagtggcgacgttcttgcaggtgtacaagaagaagtcgacgggagggtacagctcggtgccgtacgtggtggcgctcttcagctcggtgctgtggatcttctacgcgctggtgaagaccaactcgaggccgctgctgaccatcaacgccttcggctgcggcgtcgaggccgcctacatcgtcctctacctcgtctacgcgccgcgccgcgccaggctccgcaccctcgccttcttcctcctcctcgacgtcgccgccttcgccctcatcgtcgtcaccaccctctacctcgtccccaagccccaccaggtcaagttcctcggcagcgtctgcctcgccttctccatggccgtcttcgtcgcccctctctccatcatcttcaaggtgatcaagaccaagagcgtcgagttcatgccgatcgggctctccgtctgcctcacgctcagcgccgtcgcgtggttctgctacggcctcttcaccaaggacccctacgtcatgtacccgaacgtgggcggcttcttcttcagctgcgtgcagatggggctctacttctggtaccggaagccgaggaacacggccgtgctgccgacgacgtccgactccatgtccccgatctccgccgccgccgccgccacgcagagggtgatcgagctccccgccggcacgcacgccttcaccatcctgtccgtgagccccatcccgatcctcggcgtgcacaaggtcgaggtggtggccgccgagcaggcggccgacggcgtcgccgccgccgccgccgccgacaaggagctgctgcagaacaagccggaggtgatcgagatcaccgccgccgtgtga</cdnaseq> |
| Protein Sequence |
<aaseq>MAGGFLSMANPAVTLSGVAGNIISFLVFLAPVATFLQVYKKKST GGYSSVPYVVALFSSVLWIFYALVKTNSRPLLTINAFGCGVEAAYIVLYLVYAPRRAR LRTLAFFLLLDVAAFALIVVTTLYLVPKPHQVKFLGSVCLAFSMAVFVAPLSIIFKVI KTKSVEFMPIGLSVCLTLSAVAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRK PRNTAVLPTTSDSMSPISAAAAATQRVIELPAGTHAFTILSVSPIPILGVHKVEVVAA EQAADGVAAAAAADKELLQNKPEVIEITAAV</aaseq> |
| Gene Sequence |
<dnaseqindica>2087..2422#1875..1994#1408..1780#1273..1309#172..229#acacatgcagttgtagtagcacttaagccttcctctctagctagcatctcttgtgtcaggaagttggaagggatttctggctagtttctagctggtgtctcctctcctcttcctaaccttctcactgattaacaccttagagttagttaataaccttcatcaccagtagcaatggcaggaggtttcttgtccatggctaacccggcggtcaccctctccggtgttgcaggtaaagcatgcaaccaatgcataatgctcaaacttaatttcatcatcatcatcatcatcatcatcttcacagccatgatcatccatggacaaatgcaactgaagatcattttagttttcatatgctaatgatcaaattcaggttaattgctgtttaatttctccatacactagttgttgtctgcaccattgcattgtgcacagcacacacacgcttttgatgcttctaggaatgcatatctgttcagcagttcacacagtgcagcagggcaatgttgttaaaaaatcttctccttttttttatgtccttgtgttcttgagctttctgtctccattgatctgcttttttcttgtttacaagtgatgggcacaagtcacttccctagcttcagctcatgcatggagcaggaatctcacttcaaaagacctagcactttttctctcttcacctttttgcctcaacacatgcccagtttctggccacacaaacataaacacatatactatctagctgcataattgcatcaaattaagcagggtttgtttcagctaggaattccacacataggtcattaattagtattgccaactttctcaacatgcatgcactctagtactctacctaagctagctcccagattagcttctgctaatttaattccgatttcttgaaatggagatcggttgagcagtgagggaggcgtgcatctgctcctcttcgtcgctgtcactaaacaaaagcagagctagctaggtggtaacaaactgatttgatttttgtcagtaaacaaaaatgaccaattaatgacccatcaaccagtttcaattctcgatcctaacctagctaacatctctgaaactctgaaagaacattactatcttactgacagtgtatatatatgcaaactaaaattttattttattttatcctaacctagctaacatatctgcatccgtgtgaaccagctgaaactctgaaagaatgttactccactgatcatatattaattaacgatgtcgttttctgtcttgtttcttttgcaggaaacatcatctccttcctggtgttccttgcaccagtgtgagtactccattcctactgtcaccatcaaaatctcgagagaaacatctgaatatctctgacgacgaactggaatttatatctctgaaaaattgcagggcgacgttcttgcaggtgtacaagaagaagtcgacgggagggtacagctcggtgccgtacgtggtggcgctcttcagctcggtgctgtggatcttctacgcgctggtgaagaccaactcgaggccgctgctgaccatcaacgccttcggctgcggcgtcgaggccgcctacatcgtcctctacctcgtctacgcgccgcgccgcgccaggctccgcaccctcgccttcttcctcctcctcgacgtcgccgccttcgccctcatcgtcgtcaccaccctctacctcgtccccaagccccaccaggtcaagttcctcggcagcgtctgcctcgccttctccatggccgtcttcgtcgcccctctctccatcatcgtaagcttaagctctctaccccccctctacatttcactgacatcaattgcattatgtagctgagcatttctgttgatgatgatgatgcttgcagttcaaggtgatcaagaccaagagcgtcgagttcatgccgatcgggctctccgtctgcctcacgctcagcgccgtcgcgtggttctgctacggcctcttcaccaaggacccctacgtcatggtgagctcagctgccgccattgatagagctgctcgacgacgccattgttgtgaattgttttgagctgacttgcatttcttggtgcgatgcagtacccgaacgtgggcggcttcttcttcagctgcgtgcagatggggctctacttctggtaccggaagccgaggaacacggccgtgctgccgacgacgtccgactccatgtccccgatctccgccgccgccgccgccacgcagagggtgatcgagctccccgccggcacgcacgccttcaccatcctgtccgtgagccccatcccgatcctcggcgtgcacaaggtcgaggtggtggccgccgagcaggcggccgacggcgtcgccgccgccgccgccgccgacaaggagctgctgcagaacaagccggaggtgatcgagatcaccgccgccgtgtgacgacgactgatctcgacgacgacagattctcgctactgatgaagaagacgacgacgatggccggatcgatgacggacagaatttagcagtgtggattactaccgaactttaattagttggttaattattggattacaatgtggtaagagtgtgtcattagcagctagttaacttacttaaattaattatcttgttcagtcagtcagtcagtcagtcagtcagtcagctttgagtgagtgagtgagtgatctcgacgtagtttgctggttggtgtaataagaaaaaggcgatctactagtagtctactagctagtacgcatgcatgtgtgtgtgctctacttaccgtgttgcaatctcatctctttgtacttacaactcagaaatcaatggaagattgtgacaggtattattagtagttact</dnaseqindica> |
| External Link(s) |