Difference between revisions of "Os08g0535200"

From RiceWiki
Jump to: navigation, search
(References)
Line 1: Line 1:
Please input one-sentence summary here.
+
Xa13 is a gene controlling of rice disease resistance genes and the reproductive growth of rice.
 
 
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
Xa13 is a recessive resistance to bacterial leaf blight gene.Through the expression of RNA interference suppression xa13, to enhance the resistance of xa13 mediated, suggests xa13 dominant allele lack of dialogue leaf blight resistance is a must. It is worth noting that from cultivars determined dominant allele identified in Xa13, if inhibition of its expression, the enhancement of strain PX099 resistance at the same time, also can cause rice male sterility (pollen), reduce the seed setting rate.
 
+
===Localization===
 +
Rice xa13 recessive resistance gene is Os - 8 N3 alleles, Os - 8 N3 element (NODULIN3, N3) root nodules and belongs to one of the members of the family, Xa13 is Located in the chromosome 8.
 
===Expression===
 
===Expression===
Please input expression information here.
+
Os - 8 n3 is a pathogen of bacterial leaf blight disease genes, the resistance of recessive alleles can be those who have a class III effect AvrXa7, PthXo2 or PthXo3 pathogen small kind of damage, the effects of child all belong to class members of the family of transcription activation son son (TAL) effect. AvrXa7 PthXo3 can activate the N3 and another member of the family genes Os - 11 N3 expression. Os - 11 n3 insertion mutation or mediated by RNA silence, for those who rely on AvrXa7 and PthXo3 disease specific disease of small kind of loss. Results further indicated that AvrXa7 drive Os - 11 n3 expression, and AvrXa7 can with Os - 11 n3 promoter specific combination of component interactions.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
1.the researches of TAL effect specific combination model
 
+
2.TAL effect child repetitive structure domain by choice, used to overcome the explicit and implicit two forms of rice bacterial leaf blight resistance
 +
3.Researchers find two proteins:Os-8N3 and Os-11N3 ,they are coding close relatives,and the functions are studied.
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  

Revision as of 09:39, 25 May 2014

Xa13 is a gene controlling of rice disease resistance genes and the reproductive growth of rice.

Annotated Information

Function

Xa13 is a recessive resistance to bacterial leaf blight gene.Through the expression of RNA interference suppression xa13, to enhance the resistance of xa13 mediated, suggests xa13 dominant allele lack of dialogue leaf blight resistance is a must. It is worth noting that from cultivars determined dominant allele identified in Xa13, if inhibition of its expression, the enhancement of strain PX099 resistance at the same time, also can cause rice male sterility (pollen), reduce the seed setting rate.

Localization

Rice xa13 recessive resistance gene is Os - 8 N3 alleles, Os - 8 N3 element (NODULIN3, N3) root nodules and belongs to one of the members of the family, Xa13 is Located in the chromosome 8.

Expression

Os - 8 n3 is a pathogen of bacterial leaf blight disease genes, the resistance of recessive alleles can be those who have a class III effect AvrXa7, PthXo2 or PthXo3 pathogen small kind of damage, the effects of child all belong to class members of the family of transcription activation son son (TAL) effect. AvrXa7 PthXo3 can activate the N3 and another member of the family genes Os - 11 N3 expression. Os - 11 n3 insertion mutation or mediated by RNA silence, for those who rely on AvrXa7 and PthXo3 disease specific disease of small kind of loss. Results further indicated that AvrXa7 drive Os - 11 n3 expression, and AvrXa7 can with Os - 11 n3 promoter specific combination of component interactions.

Evolution

1.the researches of TAL effect specific combination model 2.TAL effect child repetitive structure domain by choice, used to overcome the explicit and implicit two forms of rice bacterial leaf blight resistance 3.Researchers find two proteins:Os-8N3 and Os-11N3 ,they are coding close relatives,and the functions are studied. You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

1. Changyan Li;Jing Wei;Yongjun Lin;Hao Chen

 Gene silencing using the recessive rice bacterial blight resistance gene xa13 as a new paradigm in plant breeding
 Plant Cell Reports, 2012, 31(5): 851-862

2. Ting Yuan;Xianghua Li;Jinghua Xiao;Shiping Wang

 Characterization of Xanthomonas oryzae-Responsive cis-Acting Element in the Promoter of Rice Race-Specific Susceptibility Gene Xa13
 Molecular Plant, 2011, 4(2): 300-309

3. Ginny Antony;Junhui Zhou;Sheng Huang;Ting Lib;Bo Liu;Frank White;Bing Yang

 Rice xa13 Recessive Resistance to Bacterial Blight Is Defeated by Induction of the Disease Susceptibility Gene Os-11N3
 The Plant Cell, 2010, 22(11): 3864-3876

4. Meng Yuan;Zhaohui Chu;Xianghua Li;Caiguo Xu;Shiping Wang

 The Bacterial Pathogen Xanthomonas oryzae Overcomes Rice Defenses by Regulating Host Copper Redistribution
 The Plant Cell, 2010, 22(9): 3164-3176

5. Zhaohui Chu;Meng Yuan;Jialing Yao;Xiaojia Ge;Bin Yuan;Caiguo Xu;Xianghua Li;Binying Fu;Zhikang Li;Jeffrey L. Bennetzen;Qifa Zhang and Shiping Wang

 Promoter mutations of an essential gene for pollen development result in disease resistance in rice
 GENES & DEVELOPMENT, 2006, 20(10): 1250-1255

6. Zhaohui Chu;Binying Fu;Hong Yang;Caiguo Xu;Zhikang Li;A. Sanchez;Y. J. Park;J. L. Bennetzen;Qifa Zhang and Shiping Wang

 Targeting xa13, a recessive gene for bacterial blight resistance in rice
 Theoretical and Applied Genetics, 2006, 112(3): 455-461

7. Marella Lalitha Shanti; M. L. C. George; C. M. Vera Cruz; M. A. Bernardo; R. J. Nelson; H. Leung; J. N. Reddy and R. Sridhar

 Identification of Resistance Genes Effective Against Rice Bacterial Blight Pathogen in Eastern India
 Phytopathology, 2001, 85(5): 506-512

8. A. C. Sanchez;L. L. Ilag;D. Yang;D. S. Brar;F. Ausubel;G. S. Khush;M. Yano;T. Sasaki;Z. Li;N. Huang

 Genetic and physical mapping of xa13, a recessive bacterial blight resistance gene in rice
 Theoretical and Applied Genetics, 1999, 98(6-7): 1022-1028

9. G. Zhang;E. R. Angeles;M. L. P. Abenes;G. S. Khush and N. Huang

 RAPD and RFLP mapping of the bacterial blight resistance gene xa-13 in rice
 Theoretical and Applied Genetics, 1996, 93(1-2): 65-70

10. T. OGAWA, Luo LIN, R. E. TABIEN and G. S. KHUSH

 A new recessive gene for resistance to bacterial blight of rice
 Rice Genetics Newsletters, 1987, 4(0): 98-100

Structured Information

Gene Name

Os08g0535200

Description

Similar to MtN3-like protein

Version

NM_001068889.1 GI:115477516 GeneID:4346153

Length

2843 bp

Definition

Oryza sativa Japonica Group Os08g0535200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:26813957..26816799

Sequence Coding Region

26814378..26814713,26814806..26814925,26815020..26815392,26815491..26815527,26816571..26816628

Expression

GEO Profiles:Os08g0535200

Genome Context

<gbrowseImage1> name=NC_008401:26813957..26816799 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:26813957..26816799 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcaggaggtttcttgtccatggctaacccggcggtcaccctctccggtgttgcaggaaacatcatctccttcctggtgttccttgcaccagtggcgacgttcttgcaggtgtacaagaagaagtcgacgggagggtacagctcggtgccgtacgtggtggcgctcttcagctcggtgctgtggatcttctacgcgctggtgaagaccaactcgaggccgctgctgaccatcaacgccttcggctgcggcgtcgaggccgcctacatcgtcctctacctcgtctacgcgccgcgccgcgccaggctccgcaccctcgccttcttcctcctcctcgacgtcgccgccttcgccctcatcgtcgtcaccaccctctacctcgtccccaagccccaccaggtcaagttcctcggcagcgtctgcctcgccttctccatggccgtcttcgtcgcccctctctccatcatcttcaaggtgatcaagaccaagagcgtcgagttcatgccgatcgggctctccgtctgcctcacgctcagcgccgtcgcgtggttctgctacggcctcttcaccaaggacccctacgtcatgtacccgaacgtgggcggcttcttcttcagctgcgtgcagatggggctctacttctggtaccggaagccgaggaacacggccgtgctgccgacgacgtccgactccatgtccccgatctccgccgccgccgccgccacgcagagggtgatcgagctccccgccggcacgcacgccttcaccatcctgtccgtgagccccatcccgatcctcggcgtgcacaaggtcgaggtggtggccgccgagcaggcggccgacggcgtcgccgccgccgccgccgccgacaaggagctgctgcagaacaagccggaggtgatcgagatcaccgccgccgtgtga</cdnaseq>

Protein Sequence

<aaseq>MAGGFLSMANPAVTLSGVAGNIISFLVFLAPVATFLQVYKKKST GGYSSVPYVVALFSSVLWIFYALVKTNSRPLLTINAFGCGVEAAYIVLYLVYAPRRAR LRTLAFFLLLDVAAFALIVVTTLYLVPKPHQVKFLGSVCLAFSMAVFVAPLSIIFKVI KTKSVEFMPIGLSVCLTLSAVAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRK PRNTAVLPTTSDSMSPISAAAAATQRVIELPAGTHAFTILSVSPIPILGVHKVEVVAA EQAADGVAAAAAADKELLQNKPEVIEITAAV</aaseq>

Gene Sequence

<dnaseqindica>2087..2422#1875..1994#1408..1780#1273..1309#172..229#acacatgcagttgtagtagcacttaagccttcctctctagctagcatctcttgtgtcaggaagttggaagggatttctggctagtttctagctggtgtctcctctcctcttcctaaccttctcactgattaacaccttagagttagttaataaccttcatcaccagtagcaatggcaggaggtttcttgtccatggctaacccggcggtcaccctctccggtgttgcaggtaaagcatgcaaccaatgcataatgctcaaacttaatttcatcatcatcatcatcatcatcatcttcacagccatgatcatccatggacaaatgcaactgaagatcattttagttttcatatgctaatgatcaaattcaggttaattgctgtttaatttctccatacactagttgttgtctgcaccattgcattgtgcacagcacacacacgcttttgatgcttctaggaatgcatatctgttcagcagttcacacagtgcagcagggcaatgttgttaaaaaatcttctccttttttttatgtccttgtgttcttgagctttctgtctccattgatctgcttttttcttgtttacaagtgatgggcacaagtcacttccctagcttcagctcatgcatggagcaggaatctcacttcaaaagacctagcactttttctctcttcacctttttgcctcaacacatgcccagtttctggccacacaaacataaacacatatactatctagctgcataattgcatcaaattaagcagggtttgtttcagctaggaattccacacataggtcattaattagtattgccaactttctcaacatgcatgcactctagtactctacctaagctagctcccagattagcttctgctaatttaattccgatttcttgaaatggagatcggttgagcagtgagggaggcgtgcatctgctcctcttcgtcgctgtcactaaacaaaagcagagctagctaggtggtaacaaactgatttgatttttgtcagtaaacaaaaatgaccaattaatgacccatcaaccagtttcaattctcgatcctaacctagctaacatctctgaaactctgaaagaacattactatcttactgacagtgtatatatatgcaaactaaaattttattttattttatcctaacctagctaacatatctgcatccgtgtgaaccagctgaaactctgaaagaatgttactccactgatcatatattaattaacgatgtcgttttctgtcttgtttcttttgcaggaaacatcatctccttcctggtgttccttgcaccagtgtgagtactccattcctactgtcaccatcaaaatctcgagagaaacatctgaatatctctgacgacgaactggaatttatatctctgaaaaattgcagggcgacgttcttgcaggtgtacaagaagaagtcgacgggagggtacagctcggtgccgtacgtggtggcgctcttcagctcggtgctgtggatcttctacgcgctggtgaagaccaactcgaggccgctgctgaccatcaacgccttcggctgcggcgtcgaggccgcctacatcgtcctctacctcgtctacgcgccgcgccgcgccaggctccgcaccctcgccttcttcctcctcctcgacgtcgccgccttcgccctcatcgtcgtcaccaccctctacctcgtccccaagccccaccaggtcaagttcctcggcagcgtctgcctcgccttctccatggccgtcttcgtcgcccctctctccatcatcgtaagcttaagctctctaccccccctctacatttcactgacatcaattgcattatgtagctgagcatttctgttgatgatgatgatgcttgcagttcaaggtgatcaagaccaagagcgtcgagttcatgccgatcgggctctccgtctgcctcacgctcagcgccgtcgcgtggttctgctacggcctcttcaccaaggacccctacgtcatggtgagctcagctgccgccattgatagagctgctcgacgacgccattgttgtgaattgttttgagctgacttgcatttcttggtgcgatgcagtacccgaacgtgggcggcttcttcttcagctgcgtgcagatggggctctacttctggtaccggaagccgaggaacacggccgtgctgccgacgacgtccgactccatgtccccgatctccgccgccgccgccgccacgcagagggtgatcgagctccccgccggcacgcacgccttcaccatcctgtccgtgagccccatcccgatcctcggcgtgcacaaggtcgaggtggtggccgccgagcaggcggccgacggcgtcgccgccgccgccgccgccgacaaggagctgctgcagaacaagccggaggtgatcgagatcaccgccgccgtgtgacgacgactgatctcgacgacgacagattctcgctactgatgaagaagacgacgacgatggccggatcgatgacggacagaatttagcagtgtggattactaccgaactttaattagttggttaattattggattacaatgtggtaagagtgtgtcattagcagctagttaacttacttaaattaattatcttgttcagtcagtcagtcagtcagtcagtcagtcagctttgagtgagtgagtgagtgatctcgacgtagtttgctggttggtgtaataagaaaaaggcgatctactagtagtctactagctagtacgcatgcatgtgtgtgtgctctacttaccgtgttgcaatctcatctctttgtacttacaactcagaaatcaatggaagattgtgacaggtattattagtagttact</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0535200, RefSeq:Os08g0535200