Difference between revisions of "Os10g0528300"
(→Function) |
(→Function) |
||
| Line 5: | Line 5: | ||
heavy metals. | heavy metals. | ||
[[File:GSTs function.png]] | [[File:GSTs function.png]] | ||
| − | Heavy metals were found to rapidly and markedly induce osgstu4 and osgstu3 in Oryza sativa. Stress responses of osgstu4 and osgstu3 suggest involvement in the detoxification of heavy metals or stress metabolites in rice roots. Osgstu4 and osgstu3 were induced by heavy metals and hypoxic stress and were differentially responsive to salt stress in rice roots, and suggested that reactive oxygen species and redox changes are involved in the complex stress response regulation of osgstu4 and osgstu3 expression. | + | Heavy metals were found to rapidly and markedly induce osgstu4 and osgstu3 in Oryza sativa. Stress responses of osgstu4 and osgstu3 suggest involvement in the detoxification of heavy metals or stress metabolites in rice roots. Osgstu4 and osgstu3 were induced by heavy metals and hypoxic stress and were differentially responsive to salt stress in rice roots, and suggested that reactive oxygen species and redox changes are involved in the complex stress response regulation of osgstu4 and osgstu3 expression.These results suggest that OsGSTU4 can be used as a good candidate for the generation of stress-tolerant crop plants. |
===Expression=== | ===Expression=== | ||
Revision as of 14:02, 25 May 2014
Os10g0528300 is Oryza sativa Indica Group mRNA for glutathione S-transferase (gstu4 gene).
Contents
Annotated Information
Function
Three glutathione S-transferases (GSTs: OsGSTU3, OsGSTU4 and OsGSTU12) that belong to the plant-specific tau class were markedly overexpressed in roots following Cd(Cadmium) exposure.GSTs have been reported to be involved in the direct quenching of Cd ions, forming GSH–Cd complexes (Adamis et al., 2004).The RT-PCR product levels of the osgstu3 and osgstu4 genes in rice roots increase in response to salicylic acid,jasmonic acid and the auxina-naphthalene acetic acid, as well as
heavy metals.
Heavy metals were found to rapidly and markedly induce osgstu4 and osgstu3 in Oryza sativa. Stress responses of osgstu4 and osgstu3 suggest involvement in the detoxification of heavy metals or stress metabolites in rice roots. Osgstu4 and osgstu3 were induced by heavy metals and hypoxic stress and were differentially responsive to salt stress in rice roots, and suggested that reactive oxygen species and redox changes are involved in the complex stress response regulation of osgstu4 and osgstu3 expression.These results suggest that OsGSTU4 can be used as a good candidate for the generation of stress-tolerant crop plants.
Expression
Many evidences show crosstalk between various developmental processes and environmental stimuli. The relationship between tissue-developmental stage-specific expression pattern and stress responses of few GST genes.OsGSTU4is preferentially expressed in the root and stages of seed development and was also found to be highly up-regulated by plant hormones, abiotic stress, arsenate stress and biotic stress conditions.
Evolution
Previous research identified a total of 79 GST genes in the rice genome and classified them in various families. On the basis of protein sequence alignment and
evolutionary relationship, fifty two (52) GST genes were included in tau, 17 in phi, 4 in zeta, two in DHAR, two in EF1G and one each in theta and tetrachlorohydroquinone dehalogenase (TCHQD) classes.Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os10g0528300 |
|---|---|
| Description |
Tau class GST protein 4 |
| Version |
NM_001071658.1 GI:115483059 GeneID:4349189 |
| Length |
1397 bp |
| Definition |
Oryza sativa Japonica Group Os10g0528300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 10:21011686..21013082 |
| Sequence Coding Region |
21011756..21012088,21012317..21012703 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008403:21011686..21013082 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008403:21011686..21013082 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggccggatcaggagacgagctgatgctgctcggcaaatggccaagcccattcgtcaccagggttgagctcgcgctcggcctcaagggcctcagctacgagtacgtcaagcaggacctcgtcaacaagagcgagctcctcctcgcctccaacccggtgcacaagaagatccccgtgctcatccacaacggcaagccggtctgcgagtcgtcaatcatcgtgcagtacatcgacgaggccttccccgacgccggcgccggcgccgccctgctccccgccgacccctacgagcgcgccgtcgctcgcttctgggtcgcctacgtcgacgacaagttcgttccggcatgggtggcgacgttcagaggcaagacggaggaggagaaggcggaggggatgaagcaactgctcgcggcggtggagacgctggagggagccctgaaggattgctccaaggggaagcccttcttcggcggcgacacagtcgggatcgtggacgtcgcgcttggtggcctcatctcgtgggtgaaagcgaccgaggtgctcgctggctccaagatcttcgacgaggagaaggcccctcttttggccgcgtgggcgcagcgcttcggcgagctcgacgtcgccgagaaggtgttgccggatgtcgacggggtggtcgagttcgctaagatgaggctggcagaggcagctgcggctgccgcggcggcttcaaaaaactaa</cdnaseq> |
| Protein Sequence |
<aaseq>MAGSGDELMLLGKWPSPFVTRVELALGLKGLSYEYVKQDLVNKS ELLLASNPVHKKIPVLIHNGKPVCESSIIVQYIDEAFPDAGAGAALLPADPYERAVAR FWVAYVDDKFVPAWVATFRGKTEEEKAEGMKQLLAAVETLEGALKDCSKGKPFFGGDT VGIVDVALGGLISWVKATEVLAGSKIFDEEKAPLLAAWAQRFGELDVAEKVLPDVDGV VEFAKMRLAEAAAAAAAASKN</aaseq> |
| Gene Sequence |
<dnaseqindica>71..403#632..1018#tacgcagcaaaacacaatccaaagcgtgttcatccaatcattctctgttccgctctctcaccccagcgagatggccggatcaggagacgagctgatgctgctcggcaaatggccaagcccattcgtcaccagggttgagctcgcgctcggcctcaagggcctcagctacgagtacgtcaagcaggacctcgtcaacaagagcgagctcctcctcgcctccaacccggtgcacaagaagatccccgtgctcatccacaacggcaagccggtctgcgagtcgtcaatcatcgtgcagtacatcgacgaggccttccccgacgccggcgccggcgccgccctgctccccgccgacccctacgagcgcgccgtcgctcgcttctgggtcgcctacgtcgacgacaaggtaggatagctaagctacctttccttcatttgtgtcacagttcgagctgttatctcaaaacacaaatattagggaatgatctaatatcaaataattcgaaggatgatgctctaaacccaaatcggctagcccactaccttgtgaaactagccagaaaactcccgggcatttctctcgaggtttttatctcactgatgcgatgatgtgttgggtggcgcgtgcgtgcagttcgttccggcatgggtggcgacgttcagaggcaagacggaggaggagaaggcggaggggatgaagcaactgctcgcggcggtggagacgctggagggagccctgaaggattgctccaaggggaagcccttcttcggcggcgacacagtcgggatcgtggacgtcgcgcttggtggcctcatctcgtgggtgaaagcgaccgaggtgctcgctggctccaagatcttcgacgaggagaaggcccctcttttggccgcgtgggcgcagcgcttcggcgagctcgacgtcgccgagaaggtgttgccggatgtcgacggggtggtcgagttcgctaagatgaggctggcagaggcagctgcggctgccgcggcggcttcaaaaaactaagatggatatgtttggttatgtcgtggtaactcccattgtttgggagaaaataatgtgcttgttggaaaaattatttgggagaaactaatgtgcttgttggaaaagaatagatttagttgatttagtgttttttctgtatcagtatcttgatttatgtctgaataatgcaaggaatattcaatgaagtcatgaagatgcttgtcctctgtttattcagtagttaggggatctttttcttctgttggtgtctattagtttgtgtttgcttagctttgtttatactatcgtgaactttctatataagtttttttctgtgtgagttctaaaataattgactataactctttaagtaaaggccggaatgttttattctattatt</dnaseqindica> |
| External Link(s) |