Difference between revisions of "Os08g0535200"
| Line 2: | Line 2: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | Xa13 | + | Xa13 has a recessive resistance to bacterial leaf blight. To inhibit the expression of xa13 by RNA interference, leads to enhancementof xa13 mediated resistance, it suggests the lack of xa13 dominant allele for dialogue leaf blight resistance is a must. If determined dominant allele identified in Xa13 is inhibited, the strain PX099 resistance would be enhanced,but at the same time, it also can cause rice male sterility (pollen), reduce the seed setting rate. |
===Localization=== | ===Localization=== | ||
Xa13 is Located in the chromosome 8. | Xa13 is Located in the chromosome 8. | ||
===Expression=== | ===Expression=== | ||
| − | Rice xa13 gene is Os - 8 N3 alleles, Os - 8 N3 element (NODULIN3, N3) root nodules and belongs to one of the members of the family, Os - 8 n3 is a pathogen of bacterial leaf blight disease genes | + | Xa13 is a recessive resistance to bacterial leaf blight gene, positioning two candidate genes, a kind of stretch is vegetable protein gene homologous genes rich in amino acid ,the other is a nodule gene MtN3 homologous genes.the amount of Xa13 expression in the leaf is very low, but in the ear and anther expression level is very high.Rice xa13 gene is Os - 8 N3 alleles, Os - 8 N3 element (NODULIN3, N3) root nodules and belongs to one of the members of the family, Os - 8 n3 is a pathogen of bacterial leaf blight disease genes. |
| + | The resistance of recessive alleles can be harmed by a class III effect molecular AvrXa7, PthXo2 or PthXo3 ,which produced by pathogen, these effects molecular all belong to class members of the family of transcription activation son son (TAL) effect. AvrXa7 PthXo3 can activate the expression of the N3 and another member of the family genes Os - 11 N3 . Os - 11 n3 insertion mutation or regulation of RNA silence,the specific disease susceptibility of those disease species who rely on AvrXa7 and PthXo3 would lose. AvrXa7 drive the expression of Os - 11 n3 ,and repetitive structure domain of TAL effect molecular can be choosed to overcome the explicit and implicit two forms of rice bacterial leaf blight resistance. | ||
===Evolution=== | ===Evolution=== | ||
Revision as of 14:18, 25 May 2014
Xa13 are Rice recessive resistance genes controlling of rice disease resistance and the reproductive growth .
Contents
Annotated Information
Function
Xa13 has a recessive resistance to bacterial leaf blight. To inhibit the expression of xa13 by RNA interference, leads to enhancementof xa13 mediated resistance, it suggests the lack of xa13 dominant allele for dialogue leaf blight resistance is a must. If determined dominant allele identified in Xa13 is inhibited, the strain PX099 resistance would be enhanced,but at the same time, it also can cause rice male sterility (pollen), reduce the seed setting rate.
Localization
Xa13 is Located in the chromosome 8.
Expression
Xa13 is a recessive resistance to bacterial leaf blight gene, positioning two candidate genes, a kind of stretch is vegetable protein gene homologous genes rich in amino acid ,the other is a nodule gene MtN3 homologous genes.the amount of Xa13 expression in the leaf is very low, but in the ear and anther expression level is very high.Rice xa13 gene is Os - 8 N3 alleles, Os - 8 N3 element (NODULIN3, N3) root nodules and belongs to one of the members of the family, Os - 8 n3 is a pathogen of bacterial leaf blight disease genes. The resistance of recessive alleles can be harmed by a class III effect molecular AvrXa7, PthXo2 or PthXo3 ,which produced by pathogen, these effects molecular all belong to class members of the family of transcription activation son son (TAL) effect. AvrXa7 PthXo3 can activate the expression of the N3 and another member of the family genes Os - 11 N3 . Os - 11 n3 insertion mutation or regulation of RNA silence,the specific disease susceptibility of those disease species who rely on AvrXa7 and PthXo3 would lose. AvrXa7 drive the expression of Os - 11 n3 ,and repetitive structure domain of TAL effect molecular can be choosed to overcome the explicit and implicit two forms of rice bacterial leaf blight resistance.
Evolution
1.The discovery of xa13 and its resistance to bacterial blight of rice,then mapping it, Identificating Resistance Genes Effective Against Rice Bacterial Blight Pathogen in Eastern India. 2.The researches of mechanism of action and Characterization,Now TAL effect specific combination model and TAL effect child repetitive structure domain by choice are known,there are two proteins:Os-8N3 and Os-11N3 ,they are coding close relatives,and the functions are studied. 3.However ,how to put the promoting effect of pathogen infection child as targets by host is unknown 4.XA13 participated in the redistribution of the copper.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
1. Changyan Li;Jing Wei;Yongjun Lin;Hao Chen
Gene silencing using the recessive rice bacterial blight resistance gene xa13 as a new paradigm in plant breeding Plant Cell Reports, 2012, 31(5): 851-862
2. Ting Yuan;Xianghua Li;Jinghua Xiao;Shiping Wang
Characterization of Xanthomonas oryzae-Responsive cis-Acting Element in the Promoter of Rice Race-Specific Susceptibility Gene Xa13 Molecular Plant, 2011, 4(2): 300-309
3. Ginny Antony;Junhui Zhou;Sheng Huang;Ting Lib;Bo Liu;Frank White;Bing Yang
Rice xa13 Recessive Resistance to Bacterial Blight Is Defeated by Induction of the Disease Susceptibility Gene Os-11N3 The Plant Cell, 2010, 22(11): 3864-3876
4. Meng Yuan;Zhaohui Chu;Xianghua Li;Caiguo Xu;Shiping Wang
The Bacterial Pathogen Xanthomonas oryzae Overcomes Rice Defenses by Regulating Host Copper Redistribution The Plant Cell, 2010, 22(9): 3164-3176
5. Zhaohui Chu;Meng Yuan;Jialing Yao;Xiaojia Ge;Bin Yuan;Caiguo Xu;Xianghua Li;Binying Fu;Zhikang Li;Jeffrey L. Bennetzen;Qifa Zhang and Shiping Wang
Promoter mutations of an essential gene for pollen development result in disease resistance in rice GENES & DEVELOPMENT, 2006, 20(10): 1250-1255
6. Zhaohui Chu;Binying Fu;Hong Yang;Caiguo Xu;Zhikang Li;A. Sanchez;Y. J. Park;J. L. Bennetzen;Qifa Zhang and Shiping Wang
Targeting xa13, a recessive gene for bacterial blight resistance in rice Theoretical and Applied Genetics, 2006, 112(3): 455-461
7. Marella Lalitha Shanti; M. L. C. George; C. M. Vera Cruz; M. A. Bernardo; R. J. Nelson; H. Leung; J. N. Reddy and R. Sridhar
Identification of Resistance Genes Effective Against Rice Bacterial Blight Pathogen in Eastern India Phytopathology, 2001, 85(5): 506-512
8. A. C. Sanchez;L. L. Ilag;D. Yang;D. S. Brar;F. Ausubel;G. S. Khush;M. Yano;T. Sasaki;Z. Li;N. Huang
Genetic and physical mapping of xa13, a recessive bacterial blight resistance gene in rice Theoretical and Applied Genetics, 1999, 98(6-7): 1022-1028
9. G. Zhang;E. R. Angeles;M. L. P. Abenes;G. S. Khush and N. Huang
RAPD and RFLP mapping of the bacterial blight resistance gene xa-13 in rice Theoretical and Applied Genetics, 1996, 93(1-2): 65-70
10. T. OGAWA, Luo LIN, R. E. TABIEN and G. S. KHUSH
A new recessive gene for resistance to bacterial blight of rice Rice Genetics Newsletters, 1987, 4(0): 98-100
Structured Information
| Gene Name |
Os08g0535200 |
|---|---|
| Description |
Similar to MtN3-like protein |
| Version |
NM_001068889.1 GI:115477516 GeneID:4346153 |
| Length |
2843 bp |
| Definition |
Oryza sativa Japonica Group Os08g0535200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 8:26813957..26816799 |
| Sequence Coding Region |
26814378..26814713,26814806..26814925,26815020..26815392,26815491..26815527,26816571..26816628 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008401:26813957..26816799 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008401:26813957..26816799 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcaggaggtttcttgtccatggctaacccggcggtcaccctctccggtgttgcaggaaacatcatctccttcctggtgttccttgcaccagtggcgacgttcttgcaggtgtacaagaagaagtcgacgggagggtacagctcggtgccgtacgtggtggcgctcttcagctcggtgctgtggatcttctacgcgctggtgaagaccaactcgaggccgctgctgaccatcaacgccttcggctgcggcgtcgaggccgcctacatcgtcctctacctcgtctacgcgccgcgccgcgccaggctccgcaccctcgccttcttcctcctcctcgacgtcgccgccttcgccctcatcgtcgtcaccaccctctacctcgtccccaagccccaccaggtcaagttcctcggcagcgtctgcctcgccttctccatggccgtcttcgtcgcccctctctccatcatcttcaaggtgatcaagaccaagagcgtcgagttcatgccgatcgggctctccgtctgcctcacgctcagcgccgtcgcgtggttctgctacggcctcttcaccaaggacccctacgtcatgtacccgaacgtgggcggcttcttcttcagctgcgtgcagatggggctctacttctggtaccggaagccgaggaacacggccgtgctgccgacgacgtccgactccatgtccccgatctccgccgccgccgccgccacgcagagggtgatcgagctccccgccggcacgcacgccttcaccatcctgtccgtgagccccatcccgatcctcggcgtgcacaaggtcgaggtggtggccgccgagcaggcggccgacggcgtcgccgccgccgccgccgccgacaaggagctgctgcagaacaagccggaggtgatcgagatcaccgccgccgtgtga</cdnaseq> |
| Protein Sequence |
<aaseq>MAGGFLSMANPAVTLSGVAGNIISFLVFLAPVATFLQVYKKKST GGYSSVPYVVALFSSVLWIFYALVKTNSRPLLTINAFGCGVEAAYIVLYLVYAPRRAR LRTLAFFLLLDVAAFALIVVTTLYLVPKPHQVKFLGSVCLAFSMAVFVAPLSIIFKVI KTKSVEFMPIGLSVCLTLSAVAWFCYGLFTKDPYVMYPNVGGFFFSCVQMGLYFWYRK PRNTAVLPTTSDSMSPISAAAAATQRVIELPAGTHAFTILSVSPIPILGVHKVEVVAA EQAADGVAAAAAADKELLQNKPEVIEITAAV</aaseq> |
| Gene Sequence |
<dnaseqindica>2087..2422#1875..1994#1408..1780#1273..1309#172..229#acacatgcagttgtagtagcacttaagccttcctctctagctagcatctcttgtgtcaggaagttggaagggatttctggctagtttctagctggtgtctcctctcctcttcctaaccttctcactgattaacaccttagagttagttaataaccttcatcaccagtagcaatggcaggaggtttcttgtccatggctaacccggcggtcaccctctccggtgttgcaggtaaagcatgcaaccaatgcataatgctcaaacttaatttcatcatcatcatcatcatcatcatcttcacagccatgatcatccatggacaaatgcaactgaagatcattttagttttcatatgctaatgatcaaattcaggttaattgctgtttaatttctccatacactagttgttgtctgcaccattgcattgtgcacagcacacacacgcttttgatgcttctaggaatgcatatctgttcagcagttcacacagtgcagcagggcaatgttgttaaaaaatcttctccttttttttatgtccttgtgttcttgagctttctgtctccattgatctgcttttttcttgtttacaagtgatgggcacaagtcacttccctagcttcagctcatgcatggagcaggaatctcacttcaaaagacctagcactttttctctcttcacctttttgcctcaacacatgcccagtttctggccacacaaacataaacacatatactatctagctgcataattgcatcaaattaagcagggtttgtttcagctaggaattccacacataggtcattaattagtattgccaactttctcaacatgcatgcactctagtactctacctaagctagctcccagattagcttctgctaatttaattccgatttcttgaaatggagatcggttgagcagtgagggaggcgtgcatctgctcctcttcgtcgctgtcactaaacaaaagcagagctagctaggtggtaacaaactgatttgatttttgtcagtaaacaaaaatgaccaattaatgacccatcaaccagtttcaattctcgatcctaacctagctaacatctctgaaactctgaaagaacattactatcttactgacagtgtatatatatgcaaactaaaattttattttattttatcctaacctagctaacatatctgcatccgtgtgaaccagctgaaactctgaaagaatgttactccactgatcatatattaattaacgatgtcgttttctgtcttgtttcttttgcaggaaacatcatctccttcctggtgttccttgcaccagtgtgagtactccattcctactgtcaccatcaaaatctcgagagaaacatctgaatatctctgacgacgaactggaatttatatctctgaaaaattgcagggcgacgttcttgcaggtgtacaagaagaagtcgacgggagggtacagctcggtgccgtacgtggtggcgctcttcagctcggtgctgtggatcttctacgcgctggtgaagaccaactcgaggccgctgctgaccatcaacgccttcggctgcggcgtcgaggccgcctacatcgtcctctacctcgtctacgcgccgcgccgcgccaggctccgcaccctcgccttcttcctcctcctcgacgtcgccgccttcgccctcatcgtcgtcaccaccctctacctcgtccccaagccccaccaggtcaagttcctcggcagcgtctgcctcgccttctccatggccgtcttcgtcgcccctctctccatcatcgtaagcttaagctctctaccccccctctacatttcactgacatcaattgcattatgtagctgagcatttctgttgatgatgatgatgcttgcagttcaaggtgatcaagaccaagagcgtcgagttcatgccgatcgggctctccgtctgcctcacgctcagcgccgtcgcgtggttctgctacggcctcttcaccaaggacccctacgtcatggtgagctcagctgccgccattgatagagctgctcgacgacgccattgttgtgaattgttttgagctgacttgcatttcttggtgcgatgcagtacccgaacgtgggcggcttcttcttcagctgcgtgcagatggggctctacttctggtaccggaagccgaggaacacggccgtgctgccgacgacgtccgactccatgtccccgatctccgccgccgccgccgccacgcagagggtgatcgagctccccgccggcacgcacgccttcaccatcctgtccgtgagccccatcccgatcctcggcgtgcacaaggtcgaggtggtggccgccgagcaggcggccgacggcgtcgccgccgccgccgccgccgacaaggagctgctgcagaacaagccggaggtgatcgagatcaccgccgccgtgtgacgacgactgatctcgacgacgacagattctcgctactgatgaagaagacgacgacgatggccggatcgatgacggacagaatttagcagtgtggattactaccgaactttaattagttggttaattattggattacaatgtggtaagagtgtgtcattagcagctagttaacttacttaaattaattatcttgttcagtcagtcagtcagtcagtcagtcagtcagctttgagtgagtgagtgagtgatctcgacgtagtttgctggttggtgtaataagaaaaaggcgatctactagtagtctactagctagtacgcatgcatgtgtgtgtgctctacttaccgtgttgcaatctcatctctttgtacttacaactcagaaatcaatggaagattgtgacaggtattattagtagttact</dnaseqindica> |
| External Link(s) |