Difference between revisions of "Os06g0583400"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Evolution)
Line 10: Line 10:
 
===Expression===
 
===Expression===
 
The length of OsHDAC701/HDAC1 cDNA is 1859bp, OsHDAC701/HDAC1 contains seven exons and encoding a 518 amino acid composition of protein products. Similar to other HDAC genes, HDAC702 shows a relatively high level in developing panicles and calli. The gene is clearly repressed by drought and salt. HDA702, HDA710 and HDA703 correspond respectively to OsHDAC1–3. Phylogenetic analysis indicates that the 3 rice genes belong to the same clade as AtHD1/HDA19, with HDA702 as the closest homolog of AtHD1/HDA19. AtHD1/HDA19 is the most studied HDAC gene in Arabidopsis. It is shown that over-expression of HDA702/HDAC1enhances root growth. Based on the RT-PCR of the HDAC702 gene, the gene was detected in leaves, stems, and roots, however, the levels of accumulation differed among different organs. To investigate the expression pattern of HDAC gene in response to environmental stress conditions, RT-PCR was conducted using total RNA isolated from leaves of seven day-old rice seedlings that were subjected to cold (4℃), mannitol and salt (NaCl) treatment. After these kinds of treatments, the expression of HDAC702 was increased.(Dao-Xiu Zhou et al.,2009)
 
The length of OsHDAC701/HDAC1 cDNA is 1859bp, OsHDAC701/HDAC1 contains seven exons and encoding a 518 amino acid composition of protein products. Similar to other HDAC genes, HDAC702 shows a relatively high level in developing panicles and calli. The gene is clearly repressed by drought and salt. HDA702, HDA710 and HDA703 correspond respectively to OsHDAC1–3. Phylogenetic analysis indicates that the 3 rice genes belong to the same clade as AtHD1/HDA19, with HDA702 as the closest homolog of AtHD1/HDA19. AtHD1/HDA19 is the most studied HDAC gene in Arabidopsis. It is shown that over-expression of HDA702/HDAC1enhances root growth. Based on the RT-PCR of the HDAC702 gene, the gene was detected in leaves, stems, and roots, however, the levels of accumulation differed among different organs. To investigate the expression pattern of HDAC gene in response to environmental stress conditions, RT-PCR was conducted using total RNA isolated from leaves of seven day-old rice seedlings that were subjected to cold (4℃), mannitol and salt (NaCl) treatment. After these kinds of treatments, the expression of HDAC702 was increased.(Dao-Xiu Zhou et al.,2009)
===Evolution===
+
[[File:QQ截图20140526101312.png]]===Evolution===
 
Phylogenetic analysis indicates that the HDA702, HDA710 and HDA703 rice genes belong to the same clade as AtHD1/HDA19, with HDA702 as the closest homolog of AtHD1/HDA19. AtHD1/HDA19 is the most studied HDAC gene in Arabidopsis.
 
Phylogenetic analysis indicates that the HDA702, HDA710 and HDA703 rice genes belong to the same clade as AtHD1/HDA19, with HDA702 as the closest homolog of AtHD1/HDA19. AtHD1/HDA19 is the most studied HDAC gene in Arabidopsis.
  

Revision as of 02:29, 26 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Histone deacetylases (HDAC) are important in plant gene expression. The expression of the gene OsHDAC702/HDAC1 is regulated by gene OsNAC6 and the gene OsNAC6 controls the growth of Rice seedlings roots. Over-expression of gene HDAC702/HDAC1 enhances root growth.


Expression

The length of OsHDAC701/HDAC1 cDNA is 1859bp, OsHDAC701/HDAC1 contains seven exons and encoding a 518 amino acid composition of protein products. Similar to other HDAC genes, HDAC702 shows a relatively high level in developing panicles and calli. The gene is clearly repressed by drought and salt. HDA702, HDA710 and HDA703 correspond respectively to OsHDAC1–3. Phylogenetic analysis indicates that the 3 rice genes belong to the same clade as AtHD1/HDA19, with HDA702 as the closest homolog of AtHD1/HDA19. AtHD1/HDA19 is the most studied HDAC gene in Arabidopsis. It is shown that over-expression of HDA702/HDAC1enhances root growth. Based on the RT-PCR of the HDAC702 gene, the gene was detected in leaves, stems, and roots, however, the levels of accumulation differed among different organs. To investigate the expression pattern of HDAC gene in response to environmental stress conditions, RT-PCR was conducted using total RNA isolated from leaves of seven day-old rice seedlings that were subjected to cold (4℃), mannitol and salt (NaCl) treatment. After these kinds of treatments, the expression of HDAC702 was increased.(Dao-Xiu Zhou et al.,2009) QQ截图20140526101312.png===Evolution=== Phylogenetic analysis indicates that the HDA702, HDA710 and HDA703 rice genes belong to the same clade as AtHD1/HDA19, with HDA702 as the closest homolog of AtHD1/HDA19. AtHD1/HDA19 is the most studied HDAC gene in Arabidopsis.

Labs working on this gene

1.Institute de biotechnologie des Plantes, Université Paris sud 11, 91405 Orsay, France. 2.South China Botanical Garden,Chinese Academy of Sciences, Guangzhou 510650, China

References

[1] Yongfeng Hu, Fujun Qin, Limin Huang, Qianwen Sun, Chen Li, Yu Zhao, Dao-Xiu Zhou

Rice histone deacetylase genes display specific expression patterns and developmental functions, Biochemical and Biophysical Research Communications, 2009, 388: 266–271.

[2] Wenqun Fua, Keqiang Wu, Jun Duan

Sequence and expression analysis of histone deacetylases in rice, Biochemical and Biophysical Research Communications, 2007 356: 843–850.

Structured Information

Gene Name

Os06g0583400

Description

Similar to Histone deacetylase (Fragment)

Version

NM_001064478.1 GI:115468687 GeneID:4341387

Length

5838 bp

Definition

Oryza sativa Japonica Group Os06g0583400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:23671362..23677199

Sequence Coding Region

23671839..23671946,23672074..23672154,23674571..23674634,23674728..23674819,23675373..23675603
,23676061..23676501,23676577..23677116

Expression

GEO Profiles:Os06g0583400

Genome Context

<gbrowseImage1> name=NC_008399:23671362..23677199 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:23671362..23677199 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggacgcctccgccggaggcggggggaactcgctgccgacggcgggggccgacggggccaagcggcgggtgtgctacttctacgacgcggaggtggggaactactactacgggcaggggcacccgatgaagccgcaccgcatccggatgacccacgcgctgctcgcccactacggcctcctcgaccagatgcaggtgctcaagccccacccggcgcgcgaccgcgacctctgccgcttccacgccgacgactacgtcgccttcctccgctccgtcacgccggagacccagcaggaccagatccgggcgctcaagcgcttcaacgtcggcgaggactgccccgtcttcgacggcctctacagcttctgccagacctacgccgggggatccgtcggcggcgccgtcaagctcaaccacggccacgacatcgccatcaactgggccggcggcctccaccacgccaagaagtgcgaggcctcgggattctgctacgtcaacgacatcgtcctcgccatcctcgagctcctcaaataccaccagcgtgttctctatgtggatatcgatatccaccatggggatggtgtggaggaggcgttctacacgacggacagggtgatgacggtctcgttccacaagtttggggattatttcccggggaccggggacattcgcgatattgggcactcaaaggggaagtattactctctgaatgtcccgttggacgacggtatcgacgacgagagctaccagtcgttgttcaagccgatcatggggaaggtgatggaggtttttcgccctggcgcggtggtgctccagtgcggtgcggactctctgtcgggtgataggttgggttgcttcaacctgtcaatcaggggccacgcggaatgcgtgagattcatgaggtccttcaatgtcccgctgttgctgcttggtggtggtgggtataccataagaaatgttgcgcggtgttggtgctatgagacaggagttgcacttggtcatgagctcactgacaagatgcctccaaatgagtattttgagtactttggtccagattatacacttcatgttgcaccaagtaacatggagaacaaaaacacacgccagcagttggatgatataagatcaagacttcttgataatctttcaaaacttcgacatgctcctagcgtccaatttcaagagcgaccccctgaggctgagctacctgagcaagatgaagaccaagaggatcctgatgaaaggcaccatgctgattctgatgtggaaatggatgatgtcaaacctttggatgactcaggaaggaggagcagtattcagaatgtgagagttaagagagagtctgctgaaacagatgccgcagatcaggatggtaatagggtcgctgcagagaacaccaagggcacagaacctgcggctgatggagttggttcctcgaaacaaactgttcctaccgatgcaagtgcgatggccatagacgaaccaggctccctgaaagtcgagccagataactcaaacaaattgcaagatcaaccatcggtgcaccagaagacataa</cdnaseq>

Protein Sequence

<aaseq>MDASAGGGGNSLPTAGADGAKRRVCYFYDAEVGNYYYGQGHPMK PHRIRMTHALLAHYGLLDQMQVLKPHPARDRDLCRFHADDYVAFLRSVTPETQQDQIR ALKRFNVGEDCPVFDGLYSFCQTYAGGSVGGAVKLNHGHDIAINWAGGLHHAKKCEAS GFCYVNDIVLAILELLKYHQRVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKFGDYFP GTGDIRDIGHSKGKYYSLNVPLDDGIDDESYQSLFKPIMGKVMEVFRPGAVVLQCGAD SLSGDRLGCFNLSIRGHAECVRFMRSFNVPLLLLGGGGYTIRNVARCWCYETGVALGH ELTDKMPPNEYFEYFGPDYTLHVAPSNMENKNTRQQLDDIRSRLLDNLSKLRHAPSVQ FQERPPEAELPEQDEDQEDPDERHHADSDVEMDDVKPLDDSGRRSSIQNVRVKRESAE TDAADQDGNRVAAENTKGTEPAADGVGSSKQTVPTDASAMAIDEPGSLKVEPDNSNKL QDQPSVHQKT</aaseq>

Gene Sequence

<dnaseqindica>5254..5361#5046..5126#2566..2629#2381..2472#1597..1827#699..1139#84..623#aggagagggcaaagaggggaaaagaaaaaaaaaagagataaaaaaaaaatctcctcctcctcgccgccgccgccgccgccgccatggacgcctccgccggaggcggggggaactcgctgccgacggcgggggccgacggggccaagcggcgggtgtgctacttctacgacgcggaggtggggaactactactacgggcaggggcacccgatgaagccgcaccgcatccggatgacccacgcgctgctcgcccactacggcctcctcgaccagatgcaggtgctcaagccccacccggcgcgcgaccgcgacctctgccgcttccacgccgacgactacgtcgccttcctccgctccgtcacgccggagacccagcaggaccagatccgggcgctcaagcgcttcaacgtcggcgaggactgccccgtcttcgacggcctctacagcttctgccagacctacgccgggggatccgtcggcggcgccgtcaagctcaaccacggccacgacatcgccatcaactgggccggcggcctccaccacgccaagaagtgcgaggcctcgggattctgctacgtcaacgacatcgtcctcgccatcctcgagctcctcaaataccaccaggttctctcgcgctggagagcctaataatcttgcggaattagggttttgggtgtgctaattgtttttgtattgcagcgtgttctctatgtggatatcgatatccaccatggggatggtgtggaggaggcgttctacacgacggacagggtgatgacggtctcgttccacaagtttggggattatttcccggggaccggggacattcgcgatattgggcactcaaaggggaagtattactctctgaatgtcccgttggacgacggtatcgacgacgagagctaccagtcgttgttcaagccgatcatggggaaggtgatggaggtttttcgccctggcgcggtggtgctccagtgcggtgcggactctctgtcgggtgataggttgggttgcttcaacctgtcaatcaggggccacgcggaatgcgtgagattcatgaggtccttcaatgtcccgctgttgctgcttggtggtggtgggtataccataagaaatgttgcgcggtgttggtgctatgaggtatgtatcaggggcatttcctggacatacatttctctgttgtttttgtttgaagagccttcactaatttattaactttaaagatgtatgaaatggcatagttcttctagcatccattttagcgccggcactatgcctgacatgtgtatgtagcaccttggacaactgttttgactaagcgactcacatctataagtacttatgtaaaaaaacctctgttaatcatttcaaactgttatagctattctaataagcacaactcactctgtgatgaactactatggattgtttgataattattgtacttttaatcactgaaatctaacagtatataaccaatgattgtctgagaattttatgaaatactttgagcttctaatgcttttagacgcatgtttcttttattgtaatcattattttcccgtatggtcttatttttctccttatgtttatgcagacaggagttgcacttggtcatgagctcactgacaagatgcctccaaatgagtattttgagtactttggtccagattatacacttcatgttgcaccaagtaacatggagaacaaaaacacacgccagcagttggatgatataagatcaagacttcttgataatctttcaaaacttcgacatgctcctagcgtccaatttcaagagcgaccccctgaggctgagctacctgaggtgagtgagaaattattggcattatggttcttttttgtcctgtagaattcctcagcttcaaggataaaggagtataaggcgtctttctagtagttgctgtaaataataatatttcacaatttgtatgaattgtaaatgtcagctccggaaatatcaggaatgccaaattgacaggtggttagttatttttacatgattgaattttgaaaagttcgttttttttgttttatggtcaaaagctttatattatggtatggattatctatgcagattttttcatgcttgaagtaatctgtcatgtgtgctctaatgctggcacttcacattctgttaataatgttcaaatcgactttgaattttcaagctgaatgcatataatttaaattactaattcctagcataaggaccagttgtctgatgtgtctcagtttatagctttgaaactttacaagtgttgtaagatgcccagtggcatgcccatattgattatggatgtagtttcgaaagtgagaggaaggattttcgcttagttacatctatgtgtctcgtgcagcaagatgaagaccaagaggatcctgatgaaaggcaccatgctgattctgatgtggaaatggatgatgtcaaacctttggatgactcaggaaggtatttgtttctattcagttctgtaaccgttcaggggattctagcagttagaatcatatgacatggtctgatgtatatccttttgtcttttaggaggagcagtattcagaatgtgagagttaagagagagtctgctgaaacagatgccgcagatcaggtatttttctattaaaactcattgaagtaatgttatgtgctggtggtgacagttgttatggttaatgtgtgctcaaaggtgtgtaagcagctatactttctttcatgaatagtgtattctgctgtttgttcctttctgaatggttgttgcatcttcagagagcatattgatattaaatagccgtggactgcgaaagacatcaattgtgagttgatgtgttgtgatgttgaatattttgaattttaatccttgctgtagcgacagttctgaaatttatatactcaacttttcaaattaaacactaaggattggaagagctgaatcatcatagcgaagtaaaggacaactattatgatgtgactatacaacatgaaaatctaatttcatttttctggataatgcatcagtaccatattcgtttgtctgtatcatggtttcttttatggtcctcgggtgttggtattagtttttcaaccttagcccttaattttagttaaggttgtaagatgaatgaagctatataggatccagcattgtttgattcttgagagtcagatatttaattcagatttctcaaatgttctgatgcacatttgcacccggttgggacttatttctaatagtaattctatttgataagtgatttgcataggcttcaaaagtataatttgacagtttgaccattaacttctcttacaatatattgttagtggcaacaaaaccaattcatgtggaagcacttccgaatatgaatccactggtacaacttttgtacagtaaacttgcaaatataatttgactcattgttggttagagcttacaaaatttgacttttcaagtacatggacgagttagggcaaagggaataccttttctttgcaagtgcaaatctaatttatcaattcactgtggttatgtatatcaaataatttcctcggacttgtgaaagtttgatgctcccatgttctaccgttggtcttttgctgttggtgcagttctagtaaaagaattgttgcattgatcatttaacgtcttatagtgaatcctttattggcaccaaaaagtgttattccctcgtatggaatcaaataaaaaaattatccatctcgtcaatggtcttgtttggtagaacaccgcagcagctacagtggctgcagcgggacacgcttacagttctgcttgatgaccatccactgcggtgctgccgctgttctgctcgggctgtgctgtacagtaaaaagcgctgcatgttggcctacctagcaggcccaatgtgtgctcttccgggtgctacacaagcaccgaacaggatcattgcatctaggcaacaactgcctactgcctccacagagcaatgctgtctcggtggcaatgccaatatagaaaaaaaatgcatgacaaaataggaaaaaaaatattaccacacagcttaagtttttcaaacaccagagaaaaaaaaaagagtggtgtaatttcgaaatgtagttggacctgcaagatatggacaagctgtgaggaagtggttagctcagctcacacattggagaccgcaaagagggcatgtatccaaagattcggagattcatatcctgttcttccatgagccccaaatcagtgaagtttgtcatttcaggcctaccaggaggagctacacccagggtcgggcagcacaagtgccggcacacaaccctgctgcaacatgctctgcacaacttcatcgcccttaccatggttgacctcatctggaggaaggggcaccagagttgagtcacaatccaccatggcatggcgagcaggaggtggagtgtagcatgacggatgttaagtgcggtggcagctcaatacggtatccaaggctggtgggaggagcgagatttgtagagatgaggaaaaataatagataagagatgatgctgacaagtgggctcaggggcattttaccatttgcttacactactgacaaactctgctaatggcaatttttaacggtggcgtccgtagtggcttatgagggatgtgaaaaattgctcggtaatataagggaagcatctaatttagatgtcgaataaggaaacttgttaatttcagatgtcaaataaggaattttctcttcagatgtccttgttcttttctgattaagattcagattttaccttggtttctgttaggacgcttttcaaactactaaacggtgtgttcctgtgaaaactttctatatataagttgctttaaaatatcaaatatatccatttgtcaagtttgtaataattaaaatttaattaatcatgtgctaatggttttctcgttttacgtacgtcaacttaatcctcatcttcatcttcatcagtgaaaacttaatcttcaacttaatcattctctgttggtaatagtttgccttgttatttgtatgttgcaggatggtaatagggtcgctgcagagaacaccaagggcacagaacctgcggctgatggagttggttcctcgaaacaaactgttgtaagtgctcttttatttgtgcaaacttgtaatcttgcaaaaggtagacttgcacgtaagtgaactgtcatggatctctgtggtaacaacggctgccttttcatgttttgctctttgacaactgcagcctaccgatgcaagtgcgatggccatagacgaaccaggctccctgaaagtcgagccagataactcaaacaaattgcaagatcaaccatcggtgcaccagaagacataatagttctctctaccttaaaacttagtaactgatgccatctatcatccattgattatattggagaaactcccaactttgaagcagagagttcatgccataccaaaagttatataccaaatttcgaatggtatgtacacctttcgaactggtggtgttttgtgcaatacatttatgccaggctgactattatgtggtatctattattagctttagtttaaccctgtctgctgtcgagcaatcggtatagtcgtgcaatatattctggatctatcaagcaatgtgagacggatgtcaaaccattggttgtgacttcagcaatgtatgtatatgtaagtatagggacaggcagcaggcgttactttggtggaagctacaagctttgtctctcttctcatccctaatacctacgtggggtgcgtctcgttgttgtttaggtattactgcattcttaaaagtgctcatttagggtgaaattct</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0583400, RefSeq:Os06g0583400