|
|
| Line 16: |
Line 16: |
| | | | |
| | ==References== | | ==References== |
| − |
| |
| − | ==Structured Information==
| |
| − | {{JaponicaGene|
| |
| − | GeneName = Os10g0148000|
| |
| − | Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|
| |
| − | Version = NM_001070697.2 GI:297610101 GeneID:4348109|
| |
| − | Length = 1111 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − |
| |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
| |
| − | AP = Chromosome 10:2864478..2865588|
| |
| − | CDS = 2864524..2864871|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008403:2864478..2865588
| |
| − | source=RiceChromosome10
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008403:2864478..2865588
| |
| − | source=RiceChromosome10
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga</cdnaseq>|
| |
| − | AA = <aaseq>MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH</aaseq>|
| |
| − | DNA = <dnaseqindica>47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|
| |
| − | }}
| |
| − | [[Category:Genes]]
| |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]]
| |
| − | [[Category:Japonica Genes]]
| |
| − | [[Category:Japonica Chromosome 10]]
| |
| − | [[Category:Chromosome 10]]
| |
Revision as of 06:20, 26 May 2014
Annotated Information
Function
OsCEBiP is a glycoprotein of rice consisting of 328 aa and has two lysin motifs (LysM) in the extracellular portion.
OsCEBiP RNAi results in a significant reduction in the elicitor-induced oxidative burst and gene responses, indicating
that OsCEBiP contributes to the perception of chitin. OsCEBiP lacks an intracelluar kinase domain, so it has to work
with annother protein to transduce extracelluar signal into cell. Its partner is OsCERK1.
Localization
OsCEBiP is localized at the plasma membrane of rice, together with OsCERK1.
Evolution
OsCEBiP is a homologous gene to CEBiP, which is discovered in Arabidopsis.
Labs working on this gene
References
