Difference between revisions of "Os04g0409600"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 9: Line 9:
 
Phenotypic and molecular analysis of RNA interference (RNAi) transgenic plants suggests that OsSRT1 is involved in H3K9 (Lys-9 of H3) deacetylation required for transcriptional repression of transposable elements and apoptosis-related genes. Our data suggest that OsSRT1 may have a function in the safeguard against genome instability andDNAdamage to ensure plant cell growth[1].
 
Phenotypic and molecular analysis of RNA interference (RNAi) transgenic plants suggests that OsSRT1 is involved in H3K9 (Lys-9 of H3) deacetylation required for transcriptional repression of transposable elements and apoptosis-related genes. Our data suggest that OsSRT1 may have a function in the safeguard against genome instability andDNAdamage to ensure plant cell growth[1].
  
[[File:Figure_1.OsSRT1_RNAi_induced_a_lesion_mimic_phenotype.jpg]]
+
[[File:Figure_1.OsSRT1_RNAi_induced_a_lesion_mimic_phenotype.jpg|Figure_1.OsSRT1_RNAi_induced_a_lesion_mimic_phenotype]]
  
 
OsSRT1 down-regulation induced histone H3K9 acetylation on the transposable elements and some of the hypersensitive response-related genes, suggesting that these genes may be among the primary targets of deacetylation regulated by OsSRT1[1].
 
OsSRT1 down-regulation induced histone H3K9 acetylation on the transposable elements and some of the hypersensitive response-related genes, suggesting that these genes may be among the primary targets of deacetylation regulated by OsSRT1[1].

Revision as of 07:33, 26 May 2014

OsSRT1 is one of the two SIR2-related genes found in rice.

Annotated Information

Function

Sir2 is involved in chromatin silencing at the mating-type loci, rDNA, and telomeres in yeast and is associated with lifespan extension in yeast, worms, and flies, but also in a broader range of additional functions[1].

OsSRT1 is one of the two SIR2-related genes found in rice[2].

Phenotypic and molecular analysis of RNA interference (RNAi) transgenic plants suggests that OsSRT1 is involved in H3K9 (Lys-9 of H3) deacetylation required for transcriptional repression of transposable elements and apoptosis-related genes. Our data suggest that OsSRT1 may have a function in the safeguard against genome instability andDNAdamage to ensure plant cell growth[1].

Figure_1.OsSRT1_RNAi_induced_a_lesion_mimic_phenotype

OsSRT1 down-regulation induced histone H3K9 acetylation on the transposable elements and some of the hypersensitive response-related genes, suggesting that these genes may be among the primary targets of deacetylation regulated by OsSRT1[1].

OsSRT1 is a histone acetylation enzyme, participating in acetylation of H3K9, inhibition of transposon and gene expression related to cell apoptosis. Rice SIR2 gene is important to maintain genomic stability and avoid DNA damage in the process of plant cell growth. OsSRT1 is involved in the safeguard against genome instability and/or oxidative stress, required for plant cell growth[2].

Expression

OsSRT1 is a widely expressed nuclear protein with higher levels in rapidly dividing tissues[1].

OsSRT1 RNA interference induced an increase of histone H3K9 (lysine-9 of H3) acetylation and a decrease of H3K9 dimethylation, leading to H2O2 production, DNA fragmentation, cell death, and lesions mimicking plant hypersensitive responses during incompatible interactions with pathogens, whereas overexpression of OsSRT1 enhanced tolerance to oxidative stress[3].

OsSRT1 was generally expressed in different tested rice tissues, but with higher transcript levels detected in tissues with high cell proliferation rates, such as buds, seedlings, and developing panicles[1].

Evolution

Sir2 family proteins, known also as sirtuins, are NAD1-dependent protein deacetylases. They contain a 200-amino acid domain conserved from bacteria to humans[4].

Yeast has four additional Sir2 homologs, termedHst1 to Hst4, Plant genomes seem to contain relatively fewer SIR2 homologs than the other eukaryotes[4].

Compared to other eukaryotes, plants have relatively fewer SIR2-related genes Plant predicted SRT1 proteins showed relatively high conservation. Only the N-terminal parts of the plant proteins were conserved with the animal homologs[5].

Labs working on this gene

National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University,Wuhan 430070, China

Department of Quartermaster, Military Economy Academy, Wuhan 430035, China

Institut de Biotechnologiedes Plantes, Universite´ Paris Sud 11, 91405 Orsay, France

References

[1]Limin Huang2, Qianwen Sun2, Fujun Qin, Chen Li, Yu Zhao, and Dao-Xiu Zhou* Down-Regulation of a SILENT INFORMATION REGULATOR2-Related Histone Deacetylase Gene, OsSRT1, Induces DNA Fragmentation and Cell Death in Rice. Plant Physiol. Vol. 144, 2007

[2]Blander G, Guarente L (2004) The Sir2 family of protein deacetylases.Annu Rev Biochem 73: 417–435

[3]Thordal-Christensen H, Zhang Z, Wei Y, Collinge DB (1997) Subcellular localization of H2O2in plants. H2O2accumulation in papillae and hypersensitive response during the barley powdery mildew interaction. Plant J 11: 1187–1194

[4]Frye RA (2000) Phylogenetic classification of prokaryotic and eukaryotic Sir2-like proteins. Biochem Biophys Res Commun 273: 793–798

[5] PandeyR,Muller A, NapoliCA,Selinger DA,PikaardCS,Richards EJ,Bender J, Mount DW, Jorgensen RA (2002) Analysis of histone acetyltransferase and histone deacetylase families of Arabidopsis thaliana suggests functional diversification of chromatin modification among multicellular eukaryotes.

Structured Information

Gene Name

Os04g0409600

Description

Similar to Histone deacetylase

Version

NM_001059260.1 GI:115458249 GeneID:4335765

Length

5631 bp

Definition

Oryza sativa Japonica Group Os04g0409600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:20272401..20278031

Sequence Coding Region

20274537..20274646,20274795..20274884,20275077..20275140,20275863..20275955,20276034..20276142
,20276428..20276477,20276551..20276641,20276876..20276946,20277195..20277293
,20277457..20277523,20277723..20277808

Expression

GEO Profiles:Os04g0409600

Genome Context

<gbrowseImage1> name=NC_008397:20272401..20278031 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:20272401..20278031 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atcataaaacatgtgatattgctatcaattgggctggtggatnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngagcttctcaataccatgccaggttctctatattgatatcgatgttcatcacggggatggagttgaagaagccttttatttcactgacagggtaatgactgtaagtttccacaagtatggtgattttttcttccctggcacaggtgatattaaggatataggagaaagagaaggaaaatattatgccattaacattccacttaaagatgggatagatgactccggctttactcgcctttttaaaacagttattgccaaagttgttgagacatatctgccaggtgctattgttcttcaatgcggggctgattccttggcacgggaccgtctggggtgcttcaatctgtccattgaaggccatgctgaatgtgtgaagtttgtcaagaaattcaatatccctctactggtgactgggggtggtggatacacaaaagagaatgtagcacgctgttgggctgttgaaactggtgttcttctagatacggagctcccaaatgaaattccagacaatgaatacatcaaatactttgctccagattatacattgaaagtatcgaatgtgaacatggacaacttgaatagcaagtcatatctaagttcaatcaaagtgcaagtcatggagagtttgcgggccatacaacatgcgcctggtgttcagatgcaagaggttccaccagatttttatatcccagatattgatgaagatgagctggatcctgatgaacgtgtagatcagcatacccaagacaagcagattcatcgcgatgacgagtactatgaaggtgacaacgacaatgatcatgaggacggggcccgttga</cdnaseq>

Protein Sequence

<aaseq>IIKHVILLSIGLVDXXXXXXXXXXXXXXXXXXXXXXXSFSIPCQ VLYIDIDVHHGDGVEEAFYFTDRVMTVSFHKYGDFFFPGTGDIKDIGEREGKYYAINI PLKDGIDDSGFTRLFKTVIAKVVETYLPGAIVLQCGADSLARDRLGCFNLSIEGHAEC VKFVKKFNIPLLVTGGGGYTKENVARCWAVETGVLLDTELPNEIPDNEYIKYFAPDYT LKVSNVNMDNLNSKSYLSSIKVQVMESLRAIQHAPGVQMQEVPPDFYIPDIDEDELDP DERVDQHTQDKQIHRDDEYYEGDNDNDHEDGAR</aaseq>

Gene Sequence

<dnaseqindica>2137..2246#2395..2484#2677..2740#3463..3555#3634..3742#4028..4077#4151..4241#4476..4546#4795..4893#5057..5123#5323..5408#cggtgcctttctacagcggcgttccactcgggttggtctctcccccgaggcacggccgccgccgccgccgcgctcggtctaatcggaatctatttctcgacgcgactccgcttccccggctcccctctcacccttccgcgccgccgccgccgccgcttgtagtggttggggggcgagcggccgctcgagagcgaagcgatgctggagaaagacaggatagcctacttctacgatggtacgaccgcgcattcgctaagcccccctcatctcctctccattctccctaatcactggagcaaccctagctctagctctagatgatagagcgaaatcctacgccgtctcgatgttgtgtggcttaatttcgtcgaagaaggggcatgcaattagtacctaagctgatttctagtggtgttatatgattgtggaggttggagtggatgttacggttggacggcttatgagaaattccagaactatgaacttcccaggacttgttcaactaggatttgtggtatttcagttgccctagccctaggtgcatgacgcatgattcattatcagtcagtaacataaggtggggaagcaacccttgaatcaagatttgaattagaatcgttgatccctttatctgtttaagagggcgcagtcaggctagatttggttaacaagttcctatattctttagcgccagccattttctaaaaggtcaccaacgccagccatatgtggttatttcttagatcacacataaatttccatgataagttctctcacatattttgtactaggtggtttcatgacttgtgccctcattcacccatggtcctttacatctctgtttatagagagccactcattttgcagatgtgaaaggaagttttcattgttcaaaatgtgtaatttttattactcattttgttttgatcgtttacctttttactgtgtcaatgaacaattcaggcgatgtgggcaatgtctactttgggccaaatcacccgatgaaaccacatcgactttgtatgacacatcatcttgtgctttcatatgatcttcacaagaagatggagatatatgtcagtatgaactttatttattcccttcgtttgcacttgttaactgcctaaagttcctttcacctcttacttttcacacaacgatttatgcagaggccccacaaagcatatccaacagagctcgcacagttccattctgctgattatgtggaattcttgcatcggataactcctgacacccaacacctgtatgaaaatgaattacgtagatgtatgaattatgaaacttttctcctctatgaactagtactctgggatttgttaattttacaataaaatggttgtcacatatcttgctactcatgtttaaattattataaatttatttattaagttccttacctggatctaataagtagcttagatcttcatgtacagttaaactataaggaatctcatacacaacttaaggctaattagcttcacttacatgaatgctgtcaggtgtatattcacgatatgcctatttgacaattcaaggaaaatgagggcatgtttggtcccctttcaagctcaagcaacttcccatctaacgctgcctagatagcgttggtgtttagtacagcttagcaagtcattcttcataggatgtatatccttgcccattgaagcgcatcccttgtggtcaaggtttacatgatttggtgcactaaatagttttggatatctttacagtatttatatagtattagttgcactcttctaggacacatgtgcttattttacagtttcagggcaaaataactgaacacctaacctaagtagcagagtaatctggacaaaagatccaacttacccactcttagagcttttccccaattgaagttggtttccaacataatcctcatgccttttggagctttctaacttcatttatctggttccttcatatttgttcccagacaatcttggagaagactgcccagtctttgataatctgtttgagttttgccaaatatatgctggaggaactctaggtaatatgaaaattctgaatgcttctttctaaagtgaactcttaagttcttctttgctattttagatgcggctcgcagattgaatcataaaacatgtgatattgctatcaattgggctggtggatnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnatcttttttggattctgagcttctcaataccatgccaggttctctatattgatatcgatgttcatcacggggatggagttgaagaagccttttatttcactgacaggttcatgctgtttccaataaagtcatggatatgtagttaatcatttattgctgccaatatttttccaatccaatttccatctctgtgcattttgtgaattttggtggtaccataatatttatactaattccagtctcgggcttttgattttgcagggtatactaatattgtatacttattttgattttgcagggtaatgactgtaagtttccacaagtatggtgattttttcttccctggcacaggtgatattaaggtaatgttccactaacaagctcctgaatattttttatgtactttttggtatgatgtggttggtgattggcccttctctgcattctgttttatccttacccttttcgcatgaagtgtgtgtgacatgcgtactctcatttgtgtgaaaaaagaagagacagattaaccaaagatggtccccagttgattttgtaatgcacaaaattgatagcacctgtaggtaattgtttatgagcagttaatcttgtttctttttagttctacccgccaagaggctgtaaatatgtaacatcatagagttgaactttggttttttttactggagattcttggcatgttattctatttaaatatcaaccattgtaattgggaattcaggtggttatgtatttgaaaaacgtcatactagaatgcatcataattcgtatacgcatgcttaattgtcatctgggctgacaaaaaaaaaacatgtgcacatatacgcccgtcatttgaatcttgtagtatgttaatttgttatgtatccactgtactactaggcaactttattaaataaaaatatcccaaataactggaaggtagagcaagtgtgctacaaaaagggcaaggttgaaaatgaacataaaacatgccatgttcttctcagtaacgatgatactttatatagcttcgttttaaatgattgtgctgcttcatattgatttacctgactctcatttgaaggatataggagaaagagaaggaaaatattatgccattaacattccacttaaagatgggatagatgactccggctttactcgcctttttaaaacagtaagcccactttacattactttctcatctttcatgtcattgtttagtcttatcaagttatgcatgtctattatgtaggttattgccaaagttgttgagacatatctgccaggtgctattgttcttcaatgcggggctgattccttggcacgggaccgtctggggtgcttcaatctgtccattgaaggttctgtacttcttaaatctgatgtgtacttgttgattcagcagaactgtgctctagatgtaaagttagtgaactgtgctgcatattcttggatgagctattagggttcaggcggtatcttcgagataatgtgaaaccttctctcaagtctcaattatttcttaccatagttttgagattgttattgcactaatagttctgacttattttgaaatttaaattttgtttctttgagctatacttagtgaatgatcttttaatacttgcatgtgtacttgcaaacaggccatgctgaatgtgtgaagtttgtcaagaaattcaatatccctctactggtaaggacaaaccgttactgcgtgtgatttctcttgttcctccttggatatcaatgtatttcccatcatgcaggtgactgggggtggtggatacacaaaagagaatgtagcacgctgttgggctgttgaaactggtgttcttctagatacggagctcccaaatggtattcttttcttttgcaattctgtacttctcggtccttttggcctgttgttttagaggacactactagtaatccctcaaatgcatgcaacagttcatgtattcttttcctcacatttgctggcatatcaagttgcaaacagatctatcaagaacgggattgactagtagagttccttaataatttctaaaacagcagtctgtgatatgagtttggcatgactttcctttgcagaaattccagacaatgaatacatcaaatactttgctccagattatacattgaaagtatcgaatgtgaacatggtatggaaccttttctcattggcctttgtttgtcctacggttgtttggtgcattgatatttgattgctattaggtgcatcaagtaactgtccttttattactgagtatggtctaagcatttgagctctgtagtccatttggtatttcggctattcaattggtttgtgtttgctagaagtttagaacttgcgttcctttcttgagaatgtgcaaatgccatatcacatgttgtgttttaaccggagcaggacaacttgaatagcaagtcatatctaagttcaatcaaagtgcaagtcatggagagtttgcgggccatacaacatgcgcctggtgttcagatgcaagaggttagtttttgattcacttacacgaggaaacctcccaactggaatttgctatgtaaaaaaaagggatacaagcaggacactataatattcctttccttttgttgcctatctttttcttcgttcaacatatttctgaacaagaacaatattaacatttttgcaggttccaccagatttttatatcccagatattgatgaagatgagctggatcctgatgaacgtgtagatcgtaagtgaaatactcctgggatgcattaggatgctaatatgtctgggtgtctgctgttccaagaaaacgaacggcagacagttgttttttttagtatatgttgtgtgttccacattatgctagtcctttcttcgtgttgttttcagacctttgaactttatatcgtccttatacattaactgtgtaaaatgttgcgcagagcatacccaagacaagcagattcatcgcgatgacgagtactatgaaggtgacaacgacaatgatcatgaggacggggcccgttgaaaaaggttctttgtatgatgaaactggatagagaaagtctggtgctgttgcgcggtttaacagcgttaggtgggaaatactgtcaattgacttgttaggatctaacacctttgcctgcatatagtgcgtgtacgttcctactttttaatcagttacatatgctagttgcatgcagagattgcaaattcttagtcggtggtaatgattcatagtttttggctgc</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0409600, RefSeq:Os04g0409600