Difference between revisions of "Os09g0307800"

From RiceWiki
Jump to: navigation, search
(Expression)
(Labs working on this gene)
Line 34: Line 34:
 
==Labs working on this gene==
 
==Labs working on this gene==
  
State Key Laboratory of Plant Genomics and National Center for Plant Gene Research (Beijing), Institute of Genetics andDevelopmental Biology, Chinese Academy of Sciences, Beijing 100101, China
+
*State Key Laboratory of Plant Genomics and National Center for Plant Gene Research (Beijing), Institute of Genetics andDevelopmental Biology, Chinese Academy of Sciences, Beijing 100101, China
  
Rice Research Institute, Sichuan Agricultural University, Chengdu 611130, China
+
*Rice Research Institute, Sichuan Agricultural University, Chengdu 611130, China
  
Key Laboratory for Cell Proliferation and Regulation Biology of Ministry of Education, College of Life Science, Beijing Normal University, 100875 Beijing, China
+
*Key Laboratory for Cell Proliferation and Regulation Biology of Ministry of Education, College of Life Science, Beijing Normal University, 100875 Beijing, China
  
Laboratory of Molecular and Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China
+
*Laboratory of Molecular and Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China
  
State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences,Hangzhou 310006, China
+
*State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences,Hangzhou 310006, China
  
 
==References==
 
==References==

Revision as of 08:45, 26 May 2014

Please input one-sentence summary here.

SDG724 is a class II SET domain protein and is constitutively expressed in various kinds of tissues.

Annotated Information

Funtion

  • SDG724 functions as a histone methyltransferase in vitro and contributes to a major fraction of globalhistone H3 lysine 36 (H3K36) methylation in vivo[1].
  • Histone Lys methylation in plants functions in biological processes such as flowering transition, floral organ development,carotenoid biosynthesis, shoot and root branching, pollen and macro-trichome development, and the brassinosteroid signaling pathway[2].
  • lesions in SDG724 were responsible for the late-flowering phenotype of lvp1 plants Heading date analyses showed that the flowering time defect was rescued in thetransgenic plant lines[1].
  • Long vegetative phase 1 (LVP1)/SDG724, is required for H3K36 methylation and promotes heading date in rice. The loss of function mutant lvp1 has a late flowering phenotype under both LD and SD conditions, associated with the suppressed expression of MADS50, MADS51, Ehd1, RFT1, and Hd3a. Furthermore, our results suggest a novel mechanism for the epigenetic regulation of flowering in rice, in which SDG724 mediates H3K36me2/3 deposition at the MADS50 and RFT1loci and promotes flowering through MADS50/MADS51-Ehd1-Hd3a/RFT1 pathways[3].

Expression

  • Expression analyses of flowering time genes in wild-type and lvp1 mutants revealed that Early heading date1, but not Heading date1, are misregulated in lvp1 mutants. In addition, the double mutant of lvp1 with photoperiod sensitivity5 (se5) flowered later than the se5 single mutant, indicating that lvp1 delays flowering time irrespective of photoperiod[1].
  • To investigate the role of SDG724 in aphotoperiod-insensitive background, lvp1 se5 double mutants were created using a se5 nonsense mutation in Nipponbare,the same genetic background as for the lvp1 mutant[1].
  • Genetic analysis demonstrated that the late flowering phenotype of lvp1 segregated as a complete monogenic recessive trait.Therefore, we carefully selected 1147 extremely late-heading plants from an F2 population derived from a cross between lvp1 and Minghui 63 and used a map-based cloning strategy to identify the candidate gene[1].
  • Under Beijing field conditions,lvp1 plants did not show heading even in November, 160 d after germination, when the weather became too cold for rice growth[1].
  • Chromatin structure is important for eukaryotic gene expression, and histone Lys methylation has drawn special attention due to its complex role in this process[4].
  • Ehd1, which encodes a B-type response regulator, is a unique transcriptionalregulator and promotes flowering by controlling FT-like gene expression independent of Hd1 under both SD and LD condi-tions in rice[5].

Evolution

  • SET domain–containing proteins are well annotated and characterized in Arabidopsis[6].
  • There are at least two independent flowering pathways in rice.The Heading date1 (Hd1) pathway is conserved between rice and Arabidopsis, but the Early heading date1 (Ehd1) pathway is unique to rice[5].
  • RFT1 and Hd3a encode two rice florigens and are closely linked in the genome, separated by only 11.5 kb. However, RFT1 and Hd3a have functionally diverged to control the LD and SD flowering time pathways, respectively[7].

Labs working on this gene

  • State Key Laboratory of Plant Genomics and National Center for Plant Gene Research (Beijing), Institute of Genetics andDevelopmental Biology, Chinese Academy of Sciences, Beijing 100101, China
  • Rice Research Institute, Sichuan Agricultural University, Chengdu 611130, China
  • Key Laboratory for Cell Proliferation and Regulation Biology of Ministry of Education, College of Life Science, Beijing Normal University, 100875 Beijing, China
  • Laboratory of Molecular and Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences,Hangzhou 310006, China

References

[1] ChanghuiSun,1JunFang,TaolanZhao,BoXu,FantaoZhang,LinchuanLiu,JiuyouTang,GenfaZhang,Xiaojian Deng,Fan Chen,dQian Qian,eXiaofeng Cao,and Chengcai Chu The Histone Methyltransferase SDG724 Mediates H3K36me2/3 Deposition at MADS50 and RFT1 and Promotes Flowering in Rice The Plant Cell, Vol. 24: 3235–3247

[2] Kim, S.Y., He, Y., Jacob, Y., Noh, Y.S., Michaels, S., and Amasino,R. (2005). Establishment of the vernalization-responsive, winter-annual habit in Arabidopsis requires a putative histone H3 methyltransferase. Plant Cell 17: 3301–3310.

[3] Ma, Y.M., et al. (2009). Molecular analysis of rice plants harboring a multi-functional T-DNA tagging system. J. Genet. Genomics 36:267–276.

[4] Springer, N.M., Napoli, C.A., Selinger, D.A., Pandey, R., Cone, K.C.,Chandler, V.L., Kaeppler, H.F., and Kaeppler, S.M. (2003). Comparative analysis of SET domain proteins in maize and Arabidopsis reveals multiple duplications preceding the divergence of monocots and dicots. Plant Physiol. 132: 907–925.

[5] Wu, J.I., Lessard, J., and Crabtree, G.R. (2009). Understanding the words of chromatin regulation. Cell 136: 200–206.

[6] Doi, K., Izawa, T., Fuse, T., Yamanouchi, U., Kubo, T., Shimatani, Z., Yano, M., and Yoshimura, A. (2004). Ehd1, a B-type response regulator in rice,confers short-day promotion of flowering and controls FT-like gene expression independently of Hd1. Genes Dev.18: 926–936.

[7] Komiya, R., Ikegami, A., Tamaki, S., Yokoi, S., and Shimamoto, K.(2008). Hd3a and RFT1 are essential for flowering in rice. Development 135: 767–774.

Structured Information

Gene Name

Os09g0307800

Description

Nuclear protein SET domain containing protein

Version

NM_001069362.1 GI:115478463 GeneID:4346677

Length

7580 bp

Definition

Oryza sativa Japonica Group Os09g0307800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:8605019..8612598

Sequence Coding Region

8605843..8605869,8606906..8606971,8607055..8607106,8607517..8607720,8607837..8607917
,8608003..8608174,8609280..8609358,8610514..8610613,8610960..8611059
,8611590..8611707,8612450..8612473

Expression

GEO Profiles:Os09g0307800

Genome Context

<gbrowseImage1> name=NC_008402:8605019..8612598 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:8605019..8612598 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcctcggccggcgaaaatcaggaaaaaacatgagaatgtgtttgatcaattgatcaaggcgataaaagctcctgtggactttgatctgccgcctgtattgaaagaatggaagtcaaattactatgtgccaattaagcggaatgcttatattactcggaaacgcgttgaggatgatggcattttttgttcctgtaccccttctggatcatccgcaacttgtgacaaagattgccaatgcgggatgttgttctcttgttgttcgtcgacctgtaaatgtgagaataaatgtgctaacaaaccgttccagcataggactttgaggaaaaccaaattaattaagacagagaaatgtggcaatggggtggtagctgaggaagatattaaaaaaggagaatttgtaatcgaatatgttggagaagttattgatgacagaacatgtgagcagagactatggaaaatgaagaggcagggtgacactaatttctatctttgtgaggtcagtagtaatatggtgatcgacgcgaccaacaaaggaaacatgtcgcgcttcataaatcatagctgtgagccaaacacagagatgcagaaatggactgttgagggagagaccagagttggaatttttgctcttcgtgacataaaaacgggggaggagctgacctatgattacaagtttgtccaatttggagctgatcaagattgtcactgtggatcttcaaactgtcgaaaaatgcttggcatcacaaagcctgttaactcaattgtacttcataatggaaatctgtcacaagatcagcatgtccggaagaaaagaaagacatatttggagaattgtattggggagattgtccgtttgtggcatcgacgtcacagcatgtatctcgcagcaagtatatatgacttcaatgagcgcaatggaatacatacattattgtttaccgatgcaactattgaagaatttgatttgagagaggaagattgggacttcttaccggatccagatggtcctgaggaagtgtga</cdnaseq>

Protein Sequence

<aaseq>MPRPAKIRKKHENVFDQLIKAIKAPVDFDLPPVLKEWKSNYYVP IKRNAYITRKRVEDDGIFCSCTPSGSSATCDKDCQCGMLFSCCSSTCKCENKCANKPF QHRTLRKTKLIKTEKCGNGVVAEEDIKKGEFVIEYVGEVIDDRTCEQRLWKMKRQGDT NFYLCEVSSNMVIDATNKGNMSRFINHSCEPNTEMQKWTVEGETRVGIFALRDIKTGE ELTYDYKFVQFGADQDCHCGSSNCRKMLGITKPVNSIVLHNGNLSQDQHVRKKRKTYL ENCIGEIVRLWHRRHSMYLAASIYDFNERNGIHTLLFTDATIEEFDLREEDWDFLPDP DGPEEV</aaseq>

Gene Sequence

<dnaseqindica>6730..6756#5628..5693#5493..5544#4879..5082#4682..4762#4425..4596#3241..3319#1986..2085#1540..1639#892..1009#126..149#ttctgctccgacctcacctcgcctccttcctccgccgactccctcccctccgccattgcagcctcgcctacggccttgagctcgtcgccgatccccgccaccgccgcgacctctgcctgccccccatgcctcggccggcgaaaatcagggtacacttcctcccatgcttgcacctcttcccctttccgcgtaaaccctaaacccgaaatttcctgcaatttttttttaaaaaaattttggtcgaatcttcgctagggaaccgcatctctaccgtttttgttgtgccttgcaaaggtttgtctccccttcgagagaagcagcaaggggagttatggagtatatggattaggggttcagggtctcagatgcgttcttgtgctaccttggaaggagtattttgttcattagattttttttcttttttttttttgcggggaaaagttgttgatcagacttgggatggctacagtggaaattacaggagcgatgtggtgttaggtctctaacctgcaggaaacagggcgagtattttgaattggaatacgatggcctaagtgagtgaagctttgttgggactgctagtgttgaccaggactgttggattaatccgttgaaatgagtgaacacatgactggactcttattgaccaaacgtatcttatattcgatgggattataacatggcacggccaatactctacacccattacttcattgcttttatttctccgttgttgcatacacgtgcatgacagaaaagaggctacaccatatctgagtagactgattctgttactatctctatttttgttttatatgcttgttacctcattttttgttggttaactcataattctatatgcttatttatcttcatgtctctatgctgcagaaaaaacatgagaatgtgtttgatcaattgatcaaggcgataaaagctcctgtggactttgatctgccgcctgtattgaaagaatggaagtcaaattactatgtgccaattaagcggagtatccttacccaccattgcatttaatctgtttcctttctcggagcagcaatgatttgcgtcctcctcatttatacttgcaatgtctctggttaaaatttcattccttggagcaatcattctacaaacttgagtgtatatttatcagtctctgctgtagcattctagattgattgtatatccgaaaatttactaaatcctaatgtactacaaagtataatatagcataggaaagtcagtggtttgttttttcaataatgtgtcttgtcacagggatgcatttaacaacggcttcaacaacgtgttttcacatggggttgtatttcaaaattgcttaagatggtatcttcaatattccaatctgttgaatctcatttttataacatagccatccaattactcgtttacaattgcatggctggaacatcttaatttcacaatgtaaacagaggacttgccttttactgctgtaaaatttctgtttgtctaaaattttatttagcattacggttgtccttaattctacgtaagatgcttatattactcggaaacgcgttgaggatgatggcattttttgttcctgtaccccttctggatcatccgcaacttgtgacaaagattgccaatgcgggtaatctctctctcccccctctctgctccaacttgcatccatcatatagccatgatactattatgaatatagctcgtattgaataatagcctcaaggaggcaatatatagagtgcatatagcgttaggactctaacctatagcatgtaaagggataacccatatatgcaaaagactttatattcctaactgatacaacctagagtgtttgagtctgctcttttttttttttttgtcttgaacctaacctcattaataaaatggtaagtttcttattagaataacctgtaaactttattggtattgagtgttgaggcattctaaaatactgtatttttgtgatgcaggatgttgttctcttgttgttcgtcgacctgtaaatgtgagaataaatgtgctaacaaaccgttccagcataggactttgaggaaaaccaaattaattaaggtatgattgaatcaagtttctaccattgttgagttggcagattaccatttaagctgactgtggataaatatgccattgctgtagctgatgctaataaagttttgatgcaataaatgttataaaaatagtctttcaactatgtgttccttgttaaaaatgtcagcttttcttgtgtaaagtgtaaactgtaaagtaatataggagtataggacacttgttaaaaatgtcagcttttctcgtggaaactataaagtagtatacgagtataggacgctgtgaatgataaaggaaatgttagccatatgaaataaatgagaagaaaaacttaaactatgaatccagttatggtaggatagatctcaatcagattatggtagattattaatttctttcaaaactttccgtataatatcgatacgattgggaataaacctccttgtttgggcattccttcttaagtaatgtctattatatacccctcaagtacggtaaccaggtaaaacgcccccccccccccctaggcagaatccaacctgattttaatggtgattttcatgattttaacatccattaatctggttgtctgctctcctagtttcataatgcattcctacttcctagtatagcatgattccttggtgtcctgtgaatattccactgttatgcttcttcggatttgaccaggacagggatgggttatttcttacccaatagtgctaggtcagtgtggtcaggaattctcttcatcctgctgcccatgctccttatttgtctggcctgtttgtttcacaattttcaaatcctcgttctatcatttacaactcataatacagtgcctttttacttgcttaataatcagacattttagaaacattatatccatatccctttatattttctgtatgtttggccttatgtctatgtacaatacgcgattaactaatttgtagtataccttccaacatcgccttcatatagaggcatattctatcgtcagcatatcctgtaccatagccatccaaattcctttatatctttgtgatctcatgattgacattcataatctactttcccatgtttctatactgtatttagtatttagtacagatttatccctttttatctataccctaaatgactaacagtttcttctagacagagaaatgtggcaatggggtggtagctgaggaagatattaaaaaaggagaatttgtaatcgaatatgttggagaaggtatggttttctacatcctgtgcacatacgtaaactttatttgtaagtacgtaaggatcaaaacaattcaactttattattacttctatacaaaagtatactcactccttaccatagtataagggttattgggtggatgtgacacatcatagtacaatgaatctggacagacggtctgtccagattcattgtactaggatgtgttacagccatccaaaatcacttatattatgggatggagggagtataccgaatccacagtaatacttatttttttactttttatttttttcatttttaattattaaacaattagaattaatatatacaatggtttacttgtcacggagtcttaatttttgtttgtccttgatttttttttttgcaagatatgaattgtagtactgagattcgaaagtaatgaataaaagctttacatacaaagctgtaactggtttaagtctcaaaattcaattttggtaagtcgtattctgtcccaaaatatagctacctttgtagttcaaggctatgttttgggacagggagtataaatttgttgtttgtacgtagttctaatcttatttgttcttgatgaaacaaattctaagtttggaattaatatagaagttgtacttgtcttggagttgcaatttgagtttttttatatttagtaattccaaaactcagaattcataaatattgtatctgtcttggaatctcaaccttctatcctgttaatttagttatggatttagaaattactaaaaagcaagttgtaacttacttcacttggactcttcttttaattcaagtcgtcatggtttagtcccacctagattaatgaccagatttttatccactactgtgcttaaacgtgagattttcctcagagtgtccgattagtataggtatagatagatcgataattcgatctattgatatgagttctcacattgaacatattggtaatcaaactaaagtccagaatccagattgtgggttggagggctatcatatcctccagtaaatctttttcaaactgttacaatatacaataacttggagctaaaaactaatatccacatatcttgcaaacatattgtagttattgatgacagaacatgtgagcagagactatggaaaatgaagaggcagggtgacactaatttctatctttgtgaggtcagtagtaatatggtgatcgacgcgaccaacaaaggaaacatgtcgcgcttcataaatcatagctgtgagccaaacacagagatgcagaaatggtaagttatactcttgtcagctcattcatatatgctgttcttctaacatcaccctgatatatgactagtatttatattgtttcaggactgttgagggagagaccagagttggaatttttgctcttcgtgacataaaaacgggggaggagctgacctatgattacaagtatttttgttctagttctatccttgacttcttttcatttcactcgggcataatgattcatcattttctgtatatggaactactcctggtatttaatttctcggctttacctacaggtttgtccaatttggagctgatcaagattgtcactgtggatcttcaaactgtcgaaaaatgcttggcatcacaaagcctgttaactcaattgtacttcataatggaaatctgtcacaagatcagcatgtccggaagaaaagaaagacatatttggagaattgtattggggagattgtccgtttgtggcatcgacgtcacagcatgtaagctttggtaactgtagattcttctaaccatcggatgatgtatttttcctataatctgagaatctacctatctagttatcatatactatttgggaaaatgtgataagttgtccaattcaacacctgctctctactggattgataaactcggtgttaaggttggaaatggggttagtttttcatggctgcctatgagtaacattttggctccaagtggttatgtatatcactagttttgacttcatctaacaaaaccattgagagtagatgcacagtttattttaacttccaagatgttttagtacatctgattgaggaagttgatttccctttctttctttctttcttttttaactttttgagattagatccattataaccacttgattatttatctcattgttcaggtatctcgcagcaagtatatatgacttcaatgagcgcaatggaatacatacagtgagtttgtcaacatatggcttgcatagtgtagggtgtgtaatttctggaaaaacaattttatatgttttgtattgttgtagttattgtttaccgatgcaactattgaagaatttgatttgagagaggaagattgggacttcttaccggtatgatgttcttagcattaaccaagttacaaatatgtcctatttttcttatttaacatttggatctaccgtggcaacatgcggggtatcatctagttctctatatttctagcaaccatagcctgaagtttccatgatgttgtccactttatcctctacgtcatgcagaccttttgtataatccaattttatcataaatatatttattatttcagtaggtctttcctctactttatataaaaaatagtgtttagcattgccgtctttgatttttttatgtaaaaaaaggataatagtacttctgtatcctggtggtagcattaagtgtaatggagaacaacattctatagaaacttttggccgaatgtagctttccacatcgttatagcacatgttcggatggacctgtcttttcttcttgtcagcaacattgcttgtgctccccattgagtgtgtcaaccgcaaacttttttttgtttttactgattgggctgcgtataacctcctgatctgggctcttagcaggattatgtctaagatgttcttttattgaaggtttaacttgcataatgtttaggatttaatgtgcttgtttacgattctagttgaggaccaagagcttaggaaatgtttttgtgaacctatgagcacctgcactcattctcactgtaaaaggagttgtaactgaactagtatatacctctgttagcagcaatatgttatgcaggaatccttagcaattagacaatttaccctcctctaaaattcactggaatcttgaaatatgataacaattgattgaacctcatcctccattgctcttggaataactttgatgcatctatcgcaccatcattccttggtttgtagcttacagtgtagaagtaaataatgctcactatctgagcttgggcctagtttacttgatgtttcctgactgtttacctgaacttgctgtttatgaagcctgacttaaataaccgaaccttatcatttgcttctggcaaagtaacttaaccttatatgttattttcaggatccagatggtcctgaggaagtgtgagtgatctgaaggtattggcaaaaatagtgtgcatacccaggcattttatttttctgtttatattatttgttgaggttggttatgctaggagtaggaacatattactgtactacttaagcagaacattggcctttaccatcatcagatagagcatccggtaggggtttattttctgcatcagtggttcgtgtaccccttttccattttctaaaggttaatttgaaatttccttttccatttcctaaaggagttatttgaaatttcctttctgttttttctatagtattcatggcagttgcatattatttacattcatgttagattgtctcctgtatcatttgcgtgcctagacaaacaatataacttaattctgcaatagcatgtgaattgacactcctaaatatttcaagctaatcattcccatgtccttgtggttctctgtatgaacagcttcatatgaggatgtcatcgcaactgtgtcaatcggatgattgtactgttgggatttaacatgtggaagtgtttagctgcaatcatccacccacaaatcaattcttcagagcgtgtacccaacatgatactgtcctcctaaactgtaaaaagcttttttcaattgttgaatgttcattaatttttttcaggtttgtatcaatcgaagtgcatcttgtgatgcttgtaaaaattgttggctgggtgagtttacaatcgttgttgtaacgtgcgatggtgatagtttattagtttagtttatgctgttataccatgtagttatgcttgtactgagagctacttgaaccataagatatttcggtatgtctgctctt</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0307800, RefSeq:Os09g0307800

  1. 1.0 1.1 1.2 1.3 1.4 1.5 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. Cite error: Invalid <ref> tag; no text was provided for refs named ref5
  5. 5.0 5.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref6
  6. Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  7. Cite error: Invalid <ref> tag; no text was provided for refs named ref7