Difference between revisions of "Os04g0649100"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
 
Please input one-sentence summary here.
 
Please input one-sentence summary here.
  
==Annotated Information==
+
Function
===Function===
+
 
 
Seed shattering is an important agricultural trait in crop domestication.SH4(for grain shattering quantitative trait locus on chromosome 4) andqSH1(for quantitative trait locus of seed shattering on chromosome 1) genes have been identified as required for reduced seed shattering during rice (Oryza sativa) domestication. However, the regulatory pathways of seed shattering in rice remain unknown. Here, we identified a seedshattering abortion1(shat1) mutant in a wild rice introgression line. The SHAT1gene, which encodes an APETALA2 transcription factor, is required for seed shattering through specifying abscission zone (AZ) development in rice. Genetic analyses revealed that the expression ofSHAT1in AZ was positively regulated by the trihelix transcription factorSH4. We also identified a frameshift mutant of SH4that completely eliminated AZs and showed nonshattering. Our results suggest a genetic model in which the persistent and concentrated expression of activeSHAT1andSH4in the AZ during early spikelet developmental stages is required for conferring AZ identification.qSH1 functioned downstream of SHAT1andSH4, through maintaining SHAT1andSH4expression in AZ, thus promoting AZ differentiation.
 
Seed shattering is an important agricultural trait in crop domestication.SH4(for grain shattering quantitative trait locus on chromosome 4) andqSH1(for quantitative trait locus of seed shattering on chromosome 1) genes have been identified as required for reduced seed shattering during rice (Oryza sativa) domestication. However, the regulatory pathways of seed shattering in rice remain unknown. Here, we identified a seedshattering abortion1(shat1) mutant in a wild rice introgression line. The SHAT1gene, which encodes an APETALA2 transcription factor, is required for seed shattering through specifying abscission zone (AZ) development in rice. Genetic analyses revealed that the expression ofSHAT1in AZ was positively regulated by the trihelix transcription factorSH4. We also identified a frameshift mutant of SH4that completely eliminated AZs and showed nonshattering. Our results suggest a genetic model in which the persistent and concentrated expression of activeSHAT1andSH4in the AZ during early spikelet developmental stages is required for conferring AZ identification.qSH1 functioned downstream of SHAT1andSH4, through maintaining SHAT1andSH4expression in AZ, thus promoting AZ differentiation.
  
===Expression===
+
Expression
 +
 
 
The Expression of SHAT1 in AZ Is Positively Regulated bySH4。To exploit the effect ofSHAT1on AZ differentiation, we examinedSHAT1expression during early floral development using in situ hybridization. The inflorescence and spikelet developmental stages used in this study were according to the criteria reported before. Our analyses ofSHAT1gene expression in the wild type showed that when lemma and palea primordia were first visible on the flanks of the floral meristem at sp6 stage,SHAT1mRNA showed hotspots of expression in palea andlemma primordia .Subsequently,SHAT1signal declined in lemma and palea but appeared in the inner floral organ primordia, such as stamens and carpels during stage sp7, when carpel primordia began to differentiate . When the ovule was first visible,SHAT1 transcripts were restricted to the AZ and anthers from early stagesp8. Afterwards, during late sp8 stage, SHAT1 expression accumulated to higher levels in the AZ than during early stage sp8. We also characterized SHAT1 expression patterns in GLA4. Its genetic background is very close to the wild type, as mentioned above, but itssh4-1allele is the cultivated rice type. Therefore, we used GLA4 as the sh4-1 mutant line in this study. TheSHAT1signal in GLA4 was very similar to that in the wild type, showing converging expression in AZ from early stage sp8 and becoming more intense during late stage sp8. By contrast, the sh4-2mutation completely disruptedSHAT1expression in AZ, with no signals observed during stages sp6-sp8, similar to that in theshat1mutant.
 
The Expression of SHAT1 in AZ Is Positively Regulated bySH4。To exploit the effect ofSHAT1on AZ differentiation, we examinedSHAT1expression during early floral development using in situ hybridization. The inflorescence and spikelet developmental stages used in this study were according to the criteria reported before. Our analyses ofSHAT1gene expression in the wild type showed that when lemma and palea primordia were first visible on the flanks of the floral meristem at sp6 stage,SHAT1mRNA showed hotspots of expression in palea andlemma primordia .Subsequently,SHAT1signal declined in lemma and palea but appeared in the inner floral organ primordia, such as stamens and carpels during stage sp7, when carpel primordia began to differentiate . When the ovule was first visible,SHAT1 transcripts were restricted to the AZ and anthers from early stagesp8. Afterwards, during late sp8 stage, SHAT1 expression accumulated to higher levels in the AZ than during early stage sp8. We also characterized SHAT1 expression patterns in GLA4. Its genetic background is very close to the wild type, as mentioned above, but itssh4-1allele is the cultivated rice type. Therefore, we used GLA4 as the sh4-1 mutant line in this study. TheSHAT1signal in GLA4 was very similar to that in the wild type, showing converging expression in AZ from early stage sp8 and becoming more intense during late stage sp8. By contrast, the sh4-2mutation completely disruptedSHAT1expression in AZ, with no signals observed during stages sp6-sp8, similar to that in theshat1mutant.
  
Line 16: Line 17:
 
Please input related labs here.
 
Please input related labs here.
  
==References==
 
 
Zhou Y, Lu D, Li C, et al. Genetic control of seed shattering in rice by the APETALA2 transcription factor SHATTERING ABORTION1[J]. The Plant Cell Online, 2012, 24(3): 1034-1048.
 
Zhou Y, Lu D, Li C, et al. Genetic control of seed shattering in rice by the APETALA2 transcription factor SHATTERING ABORTION1[J]. The Plant Cell Online, 2012, 24(3): 1034-1048.
  

Revision as of 09:44, 27 May 2014

Please input one-sentence summary here.

Function

Seed shattering is an important agricultural trait in crop domestication.SH4(for grain shattering quantitative trait locus on chromosome 4) andqSH1(for quantitative trait locus of seed shattering on chromosome 1) genes have been identified as required for reduced seed shattering during rice (Oryza sativa) domestication. However, the regulatory pathways of seed shattering in rice remain unknown. Here, we identified a seedshattering abortion1(shat1) mutant in a wild rice introgression line. The SHAT1gene, which encodes an APETALA2 transcription factor, is required for seed shattering through specifying abscission zone (AZ) development in rice. Genetic analyses revealed that the expression ofSHAT1in AZ was positively regulated by the trihelix transcription factorSH4. We also identified a frameshift mutant of SH4that completely eliminated AZs and showed nonshattering. Our results suggest a genetic model in which the persistent and concentrated expression of activeSHAT1andSH4in the AZ during early spikelet developmental stages is required for conferring AZ identification.qSH1 functioned downstream of SHAT1andSH4, through maintaining SHAT1andSH4expression in AZ, thus promoting AZ differentiation.

Expression

The Expression of SHAT1 in AZ Is Positively Regulated bySH4。To exploit the effect ofSHAT1on AZ differentiation, we examinedSHAT1expression during early floral development using in situ hybridization. The inflorescence and spikelet developmental stages used in this study were according to the criteria reported before. Our analyses ofSHAT1gene expression in the wild type showed that when lemma and palea primordia were first visible on the flanks of the floral meristem at sp6 stage,SHAT1mRNA showed hotspots of expression in palea andlemma primordia .Subsequently,SHAT1signal declined in lemma and palea but appeared in the inner floral organ primordia, such as stamens and carpels during stage sp7, when carpel primordia began to differentiate . When the ovule was first visible,SHAT1 transcripts were restricted to the AZ and anthers from early stagesp8. Afterwards, during late sp8 stage, SHAT1 expression accumulated to higher levels in the AZ than during early stage sp8. We also characterized SHAT1 expression patterns in GLA4. Its genetic background is very close to the wild type, as mentioned above, but itssh4-1allele is the cultivated rice type. Therefore, we used GLA4 as the sh4-1 mutant line in this study. TheSHAT1signal in GLA4 was very similar to that in the wild type, showing converging expression in AZ from early stage sp8 and becoming more intense during late stage sp8. By contrast, the sh4-2mutation completely disruptedSHAT1expression in AZ, with no signals observed during stages sp6-sp8, similar to that in theshat1mutant.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

Zhou Y, Lu D, Li C, et al. Genetic control of seed shattering in rice by the APETALA2 transcription factor SHATTERING ABORTION1[J]. The Plant Cell Online, 2012, 24(3): 1034-1048.

Structured Information

Gene Name

Os04g0649100

Description

Pathogenesis-related transcriptional factor and ERF domain containing protein

Version

NM_001187194.1 GI:297723518 GeneID:9269072

Length

2030 bp

Definition

Oryza sativa Japonica Group Os04g0649100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:33471877..33473906

Sequence Coding Region

33471878..33472020,33472167..33472296

Expression

GEO Profiles:Os04g0649100

Genome Context

<gbrowseImage1> name=NC_008397:33471877..33473906 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:33471877..33473906 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>tatgtcctaatcgatcaccgtttcttcctctttcgttcgatcgttcgttcttgggcaatctcccgtaaatcatcttgtgggtttttggtgcactgcaggtacgtctacttggggctgttcgacaccgaggaggaagctgccagggcgtacgaccgcgctgccatcaagtgcaatggcaaggatgcggtgacgaacttcgatccaagcatttacgccggggagttcgagccgccgggtgggtgtgtcatgtgtgcgcttactgctcatggctag</cdnaseq>

Protein Sequence

<aaseq>YVLIDHRFFLFRSIVRSWAISRKSSCGFLVHCRYVYLGLFDTEE EAARAYDRAAIKCNGKDAVTNFDPSIYAGEFEPPGGCVMCALTAHG</aaseq>

Gene Sequence

<dnaseqindica>2..144#291..420#gtatgtcctaatcgatcaccgtttcttcctctttcgttcgatcgttcgttcttgggcaatctcccgtaaatcatcttgtgggtttttggtgcactgcaggtacgtctacttggggctgttcgacaccgaggaggaagctgccaggtaaaattattgggccgcactgtgcgcgcgcgcggccattgttgttgaatgtcgagtgtggctgctgcgccgtttgcgagtttacgcttctgggttagatgggcgagcggtgatggtgattgatgtttcttgtctcttggccacagggcgtacgaccgcgctgccatcaagtgcaatggcaaggatgcggtgacgaacttcgatccaagcatttacgccggggagttcgagccgccgggtgggtgtgtcatgtgtgcgcttactgctcatggctaggctgttcgtttgtgagttgtgactgctcatccggacaaaatctgtcactgttttgcagcagcggccacgggtgatgccgccgagcacaacctggacctctcgcttgggagctcggcgggctccaagaggggcaacgttgacggtggcggggacgacgagatcaccggcggcggtggcggtggcgcgggctccgaccagcgcgtccctatggcgttcgaccttgactggcaaacggcggcggcgaggagcaccaaagctaaggtaaaaaaagaatggggactttgctttccgcatcagccgattgtcttctcatcacgtaataaaaaggcttaaaaattcctcgttttcttgtctagttcgaccagaactcgaaccatccccagatgcctccggtcctgcaggtcacccacctgccattcagtcccaggcatcatcaccaagtgggtagctcactatacaactccactccacttcgctccatttgctgctgaatttctcgcgtttggtttcaccggtatccgtgagctgatgaattcttgatgtctgtgctgctagttcttgagcaatggtgatccggggacagcgggaggcctgtcactgacgatcggcgcaggcatggccgggcactggcctccccagcagcagcaggggtggggcaacgccggcggcatgagctggccgcacccgccgcacccgccgccgccgccgaccaacgccgcggccgccgcaaccgctacagcagctgcagcatcatcacgattccctccctacattgcgacgcaagcctcaacctggctgcagaagaacgggttccattccctgacccggcccacctaagatgatcaaagatttaaaattcaagatcgctgcattcatcgtctcctcgtcgatcgatcatggcaaagatcgatggagagagagaggtgtgtgtcactgacgcagggaaaaactcaatgcagatttaccagcaagaacaagagctggatgctattcttttgctctaccttttttcttctctctttcttcttctctgtttcttgattgggcgagcgagatggagatggatctgatcatgaatgggacacaagtgggcatgtaaatgaggagctccctagaaggcgagagagattggccaagcgtcgcctcaagcagtgtaggagtatctatcttttgccgtttcgctcgctttctttccttcttttctttcaccatggccaacaacgatgactctgggtgtcaacatcacagctcattttgttcggtctcatgttgcatcattcactgcatgatgaccatgattcgggaaaatttgctccatgcacctccgcttggccgacaacacttgccctctagtaagcatccttaaacacccacggtttctactactattcatcgctttataaatcctacggagtgctagctttacgctactactactgtcatgtaatctatcatcatcaaaagagacgatcagattaacatatatgtcaactatttaagctttggctctttgctttccaagaaacgtaactgccgagatgtggagcatatagaagtattcgtccttctagatgttggtactaaagtaatgttctttcttttctccctct</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0649100, RefSeq:Os04g0649100