Difference between revisions of "BGIOSGA024803"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Labs working on this gene)
Line 13: Line 13:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
State Key Laboratory of Plant Physiology and Biochemistry, National Center for Evaluation of Agricultural Wild Plants (Rice), Department of Plant Genetics and
 +
Breeding, China Agricultural University, Beijing, 100094, China.
 +
 
 +
MOE Key Laboratory of Bioinformatics, Department of Biological Sciences and Biotechnology,
 +
Tsinghua University, Beijing, 100084, China.
 +
 
 +
National Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy
 +
of Sciences, 300 Fenglin Road, Shanghai 200032, China.
 +
 
 +
State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.
  
 
==References==
 
==References==

Revision as of 13:46, 27 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

State Key Laboratory of Plant Physiology and Biochemistry, National Center for Evaluation of Agricultural Wild Plants (Rice), Department of Plant Genetics and Breeding, China Agricultural University, Beijing, 100094, China.

MOE Key Laboratory of Bioinformatics, Department of Biological Sciences and Biotechnology, Tsinghua University, Beijing, 100084, China.

National Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, China.

State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.

References

Please input cited references here.

Structured Information

Gene Name

BGIOSGA024803

Description

Prostrate growth 1Putative uncharacterized protein

Definition

Oryza sativa Indica Group BGIOSGA024803, complete gene.

LocusTag

OSJNBB0050B07.12

Ensembl Transcript ID

BGIOSGA024803-TA

Ensembl Protein ID

BGIOSGA024803-PA

Length

504

Source

Oryza sativa Indica Group

 ORGANISM  Oryza sativa Indica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:2808627..2809130

Sequence Coding Region

2808627..2809130

Genome Context

<gbrowseImage1> name=IndicaChromosome07:2808627..2809130 source=RiceIndica07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=IndicaChromosome07:2808627..2809130 source=RiceIndica07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>ATGGATCCCTCATCGGCTTCTTGGCCGGCTCCGGCTTCTCCGCCGGTGGAGCTGTCCCTGTCCCTGCCGGCGGCGGCGGCGAGGAACCGCGACGAGGCGGCGCCGACGGCGATCGTCGACGGCAAGCAAGTGAGGCTGTTCCCGTGCCTCTTCTGCGCCAAGACGTTCCGCAAGTCGCAGGCGCTCGGCGGCCACCAGAACGCGCACCGGAAGGAGCGCGTCGCCGGCGGCAGCTGGAACCCCAACGTCTACGGCGACGGCGGCGGATCAGCGTCCATGCCCATCGCCTCCCATGGCGTCACGGCGGCGGGGAGTAGTACGGCAGCCGACGGCCGGTGGTGCGGCGGCGCTGCCAGCGACGACGACACAACGGCGGCGCCCATGCCTTCCCTCGGCTCAGGCTCGGCGGCGCTCGGCGCCGGCGCCGGTTTCGCTTCGACCGAAAGGGGCTCTTCCGGCGGCGGCGTCGCCGGCGAGGAGCTTGTCCTCGAGCTCGGCCTCTAG</cdnaseq>

Protein Sequence

<aaseq>MDPSSASWPAPASPPVELSLSLPAAAARNRDEAAPTAIVDGKQVRLFPCLFCAKTFRKSQALGGHQNAHRKERVAGGSWNPNVYGDGGGSASMPIASHGVTAAGSSTAADGRWCGGAASDDDTTAAPMPSLGSGSAALGAGAGFASTERGSSGGGVAGEELVLELGL</aaseq>

Gene Sequence

<dnaseqindica>1..504#ATGGATCCCTCATCGGCTTCTTGGCCGGCTCCGGCTTCTCCGCCGGTGGAGCTGTCCCTGTCCCTGCCGGCGGCGGCGGCGAGGAACCGCGACGAGGCGGCGCCGACGGCGATCGTCGACGGCAAGCAAGTGAGGCTGTTCCCGTGCCTCTTCTGCGCCAAGACGTTCCGCAAGTCGCAGGCGCTCGGCGGCCACCAGAACGCGCACCGGAAGGAGCGCGTCGCCGGCGGCAGCTGGAACCCCAACGTCTACGGCGACGGCGGCGGATCAGCGTCCATGCCCATCGCCTCCCATGGCGTCACGGCGGCGGGGAGTAGTACGGCAGCCGACGGCCGGTGGTGCGGCGGCGCTGCCAGCGACGACGACACAACGGCGGCGCCCATGCCTTCCCTCGGCTCAGGCTCGGCGGCGCTCGGCGCCGGCGCCGGTTTCGCTTCGACCGAAAGGGGCTCTTCCGGCGGCGGCGTCGCCGGCGAGGAGCTTGTCCTCGAGCTCGGCCTCTAG</dnaseqindica>

External Link(s)

EnsemblPlants:BGIOSGA024803