Difference between revisions of "Os04g0610400"

From RiceWiki
Jump to: navigation, search
(Function)
(References)
Line 18: Line 18:
  
 
==References==
 
==References==
Please input cited references here.
+
 
 +
[1]Liyun Wan;Jianfei Zhang;Haiwen Zhang;Zhijin Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang
 +
Transcriptional Activation of OsDERF1 in OsERF3 and OsAP2-39 Negatively Modulates Ethylene Synthesis and Drought Tolerance in Rice
 +
  PLoS ONE, 2011, 6(9): e25216
 +
[2] Mahmoud W. Yaish;Ashraf El-kereamy;Tong Zhu;Perrin H. Beatty;Allen G. Good;Yong-Mei Bi;Steven J. Rothstein
 +
  The APETALA-2-Like Transcription Factor OsAP2-39 Controls Key Interactions between Abscisic Acid and Gibberellin in Rice
 +
  PLoS Genetics, 2010, 6(9): e1001098
  
 
==Structured Information==
 
==Structured Information==

Revision as of 15:02, 27 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. OsAP2-39 classes in rice APETALA-2 transcription factor, an AP2 domain containing a key control between ABA and GA interaction. Interactions between plant hormones is an important mechanism for regulating plant growth and development, analysis of these interactions is the key to improve yields and improved crop resistance to environmental stress. OsAP2-39 is abundantly expressed in anthers, booting the early roots also expressed. OsAP2-39 overexpression can cause phenotypic changes in transgenic rice variety, such as plant height reduction of 55%, 75% reduction of tillers, leaf number decreased by 74% heading delayed 1-2 weeks, more sensitive to dehydration, and ultimately due to biological and reducing the amount of grain number resulted in yields.. Controlling the expression level of OsAP2-39 which includes an APETALA 2 (AP2) domain leads to phenotypic changes in rice. Overexpression of OsAP2-39 leads to a reduction in yield by decreasing the biomass and the number of seeds in the transgenic rice lines. Global transcriptome analysis of the OsAP2-39 overexpression transgenic rice revealed the upregulation of a key Abscisic Acid (ABA) biosynthetic gene OsNCED-I which codes for 9-cis-epoxycarotenoid dioxygenase and leads to an increase in the endogenous ABA level. In addition to OsNCED-1, the gene expression analysis revealed the upregulation of a gene that codes for the Elongation of Upper most Internode (EUI) protein, an enzyme that catalyzes 16α, 17-epoxidation of non-13-hydroxylated GAs, which has been shown to deactivate gibberellins (GAs) in rice. The exogenous application of GA restores the wild-type phenotype in the transgenic line and ABA application induces the expression of EUI and suppresses the expression of OsAP2-39 in the wild-type line. These observations clarify the antagonistic relationship between ABA and GA and illustrate a mechanism that leads to homeostasis of these hormones. In vivo and in vitro analysis showed that the expression of both OsNCED-1 and EUI are directly controlled by OsAP2-39. Together, these results reveal a novel mechanism for the control of the ABA/GA balance in rice which is regulated by OsAP2-39 that in turn regulates plant growth and seed production.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

[1]Liyun Wan;Jianfei Zhang;Haiwen Zhang;Zhijin Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang Transcriptional Activation of OsDERF1 in OsERF3 and OsAP2-39 Negatively Modulates Ethylene Synthesis and Drought Tolerance in Rice

 PLoS ONE, 2011, 6(9): e25216

[2] Mahmoud W. Yaish;Ashraf El-kereamy;Tong Zhu;Perrin H. Beatty;Allen G. Good;Yong-Mei Bi;Steven J. Rothstein

 The APETALA-2-Like Transcription Factor OsAP2-39 Controls Key Interactions between Abscisic Acid and Gibberellin in Rice
 PLoS Genetics, 2010, 6(9): e1001098

Structured Information

Gene Name

Os04g0610400

Description

Similar to AP2 domain containing protein RAP2.6 (Fragment)

Version

NM_001060364.1 GI:115460457 GeneID:4336947

Length

669 bp

Definition

Oryza sativa Japonica Group Os04g0610400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:31337819..31338487

Sequence Coding Region

31337819..31338487

Expression

GEO Profiles:Os04g0610400

Genome Context

<gbrowseImage1> name=NC_008397:31337819..31338487 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:31337819..31338487 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctcccaggaacgccgccgaggccgtcgccgtcgccgtggcggagggcggaggagccggcatggagcccaggttccgcggcgtgaggaagcgcccgtggggcaggtacgcggcggagatccgcgacccggccaggaaggcgcgggtgtggctcggcaccttcgacaccgccgaggccgcggcgcgcgcctacgacagcgccgcgctccacttccgcgggcccaaggccaagaccaacttccccgtcgccttcgcgcacgcccaccaccacgccccgccgccgccgctgcccaaggcggcggcgctggccgtcgtcagcccgaccagcagcacggtcgagtcgtcctcccgggacacgcccgccgccgccccggtggcggccgcggccaaggcccaggtgcccgcctcgccttcgctcgatctgagcctcgggatgtcggccatggtggccgcccagccgttcctgttcctcgaccccagggtcgcggtgaccgtggccgtcgcggcaccggtgcctcgccggccggccgtcgtcagcgtcaagaaggaggtagctcgcctggacgagcagagcgacaccggctcgtcgtcatccgtggtggacgcctcgccggccgtcggcgtggggctcgacctgaacctgccgccgccgatcgaggaggcgtag</cdnaseq>

Protein Sequence

<aaseq>MAPRNAAEAVAVAVAEGGGAGMEPRFRGVRKRPWGRYAAEIRDP ARKARVWLGTFDTAEAAARAYDSAALHFRGPKAKTNFPVAFAHAHHHAPPPPLPKAAA LAVVSPTSSTVESSSRDTPAAAPVAAAAKAQVPASPSLDLSLGMSAMVAAQPFLFLDP RVAVTVAVAAPVPRRPAVVSVKKEVARLDEQSDTGSSSSVVDASPAVGVGLDLNLPPP IEEA</aaseq>

Gene Sequence

<dnaseqindica>1..669#atggctcccaggaacgccgccgaggccgtcgccgtcgccgtggcggagggcggaggagccggcatggagcccaggttccgcggcgtgaggaagcgcccgtggggcaggtacgcggcggagatccgcgacccggccaggaaggcgcgggtgtggctcggcaccttcgacaccgccgaggccgcggcgcgcgcctacgacagcgccgcgctccacttccgcgggcccaaggccaagaccaacttccccgtcgccttcgcgcacgcccaccaccacgccccgccgccgccgctgcccaaggcggcggcgctggccgtcgtcagcccgaccagcagcacggtcgagtcgtcctcccgggacacgcccgccgccgccccggtggcggccgcggccaaggcccaggtgcccgcctcgccttcgctcgatctgagcctcgggatgtcggccatggtggccgcccagccgttcctgttcctcgaccccagggtcgcggtgaccgtggccgtcgcggcaccggtgcctcgccggccggccgtcgtcagcgtcaagaaggaggtagctcgcctggacgagcagagcgacaccggctcgtcgtcatccgtggtggacgcctcgccggccgtcggcgtggggctcgacctgaacctgccgccgccgatcgaggaggcgtag</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0610400, RefSeq:Os04g0610400