Difference between revisions of "Os03g0237250"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 23: Line 23:
  
 
==References==
 
==References==
 +
<references>
 
<ref name="ref1"> Xinru Wu;Ding Tang;Ming Li;Kejian Wang;Zhukuan Cheng.Loose Plant Architecture1, an INDETERMINATE DOMAIN Protein Involved in Shoot Gravitropism, Regulates Plant Architecture in Rice. Plant Physiology, 2013, 161(1): 317-329 </ref>
 
<ref name="ref1"> Xinru Wu;Ding Tang;Ming Li;Kejian Wang;Zhukuan Cheng.Loose Plant Architecture1, an INDETERMINATE DOMAIN Protein Involved in Shoot Gravitropism, Regulates Plant Architecture in Rice. Plant Physiology, 2013, 161(1): 317-329 </ref>
 
<ref name="ref2">Li P, Wang Y, Qian Q, Fu Z, Wang M, Zeng D, Li B, Wang X, Li J(2007)LAZY1 controls rice shoot gravitropism through regulating polar auxin transport. Cell Res 17:402–410</ref>
 
<ref name="ref2">Li P, Wang Y, Qian Q, Fu Z, Wang M, Zeng D, Li B, Wang X, Li J(2007)LAZY1 controls rice shoot gravitropism through regulating polar auxin transport. Cell Res 17:402–410</ref>

Revision as of 05:38, 28 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Loose Plant Architecture1,the functional ortholog of the AtIDD15/SHOOT GRAVITROPISM5 (SGR5) gene in Arabidopsis (Arabidopsis thaliana),regulates tiller angle and leaf angle by controlling the adaxial growth of tiller node and lamina joint. LPA1 was also found to affect shoot gravitropism.[1]


Mutation

In rice, the lazy1 mutant exhibits a tiller-spreading phenotype resulting from reduced shoot gravitropism [2]. To examine whether lpa1 was also involved in the same process, we analyzed the gravity response of young seedlings. The result revealed that both light- and dark-grown mutant seedlings had a reduced gravity response and could not grow upright eventually (Fig. 2, A–C). However,lpa1roots showed a normal gravity response (Fig. 2D). These results indicated thatLPA1is only involved in shoot gravitropism in rice.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

State Key Laboratory of Plant Genomics and Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China

References

<references> [1] [2]

Structured Information

Gene Name

Os03g0237250

Description

Zinc finger, C2H2-type domain containing protein

Version

NM_001186408.1 GI:297721946 GeneID:9270511

Length

837 bp

Definition

Oryza sativa Japonica Group Os03g0237250, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:7289669..7290505

Sequence Coding Region

7289669..7290246,7290328..7290505

Expression

GEO Profiles:Os03g0237250

Genome Context

<gbrowseImage1> name=NC_008396:7289669..7290505 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:7289669..7290505 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcactggtcaagagccaccaccaaatgttggcctcttcttccacctcgtcctcctcaccctcctcccagcagcagcagcctccaccgccggcgtcgaactcctccagcctcgccgccgccgccgccgaccagccctcccccgccaagcgcaagaggcgccctcccggcacgccagacccagatgcggaggtggtggcgctgtcgccgaggacgctgctggagtcggacaggtacgtgtgcgagatctgcgggcaggggttccagcgggagcagaacctgcagatgcaccggcgccggcacaaggtgccgtggcggctggtcaagcgccccgcggcggcgacggcggcggaggacggcggcgccgcgggtggcggcggcggcgccggcggcggcgcgggcggcggaggggcgcggaagcgcgtgttcgtgtgcccggagccgagctgcctccaccacgacccggcacacgcgctgggcgacctcgtcggcatcaagaagcacttccggcgcaagcacggcggccggcggcagtgggtgtgtgcccgctgcgccaagggctacgccgtccagtccgactacaaggcccacctcaagacctgcggcacccgcggccactcctgcgactgcggccgcgtcttctcccggtacgtacaccaccccctctcctcctcctcaaacctacgtagcgttcatggcggccggcgacgcatgcactactactactacgtacgaacgctaaccatccatgattag</cdnaseq>

Protein Sequence

<aaseq>MALVKSHHQMLASSSTSSSSPSSQQQQPPPPASNSSSLAAAAAD QPSPAKRKRRPPGTPDPDAEVVALSPRTLLESDRYVCEICGQGFQREQNLQMHRRRHK VPWRLVKRPAAATAAEDGGAAGGGGGAGGGAGGGGARKRVFVCPEPSCLHHDPAHALG DLVGIKKHFRRKHGGRRQWVCARCAKGYAVQSDYKAHLKTCGTRGHSCDCGRVFSRYV HHPLSSSSNLRSVHGGRRRMHYYYYVRTLTIHD</aaseq>

Gene Sequence

<dnaseqindica>260..837#1..178#atggcactggtcaagagccaccaccaaatgttggcctcttcttccacctcgtcctcctcaccctcctcccagcagcagcagcctccaccgccggcgtcgaactcctccagcctcgccgccgccgccgccgaccagccctcccccgccaagcgcaagaggcgccctcccggcacgccaggtacgtatatacgtatgtgttggagacattgataccatcatgcatgcatggtgttcgatcatggagcccgtgtgtacgtagacccagatgcggaggtggtggcgctgtcgccgaggacgctgctggagtcggacaggtacgtgtgcgagatctgcgggcaggggttccagcgggagcagaacctgcagatgcaccggcgccggcacaaggtgccgtggcggctggtcaagcgccccgcggcggcgacggcggcggaggacggcggcgccgcgggtggcggcggcggcgccggcggcggcgcgggcggcggaggggcgcggaagcgcgtgttcgtgtgcccggagccgagctgcctccaccacgacccggcacacgcgctgggcgacctcgtcggcatcaagaagcacttccggcgcaagcacggcggccggcggcagtgggtgtgtgcccgctgcgccaagggctacgccgtccagtccgactacaaggcccacctcaagacctgcggcacccgcggccactcctgcgactgcggccgcgtcttctcccggtacgtacaccaccccctctcctcctcctcaaacctacgtagcgttcatggcggccggcgacgcatgcactactactactacgtacgaacgctaaccatccatgattag</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0237250, RefSeq:Os03g0237250

  1. 1.0 1.1 Xinru Wu;Ding Tang;Ming Li;Kejian Wang;Zhukuan Cheng.Loose Plant Architecture1, an INDETERMINATE DOMAIN Protein Involved in Shoot Gravitropism, Regulates Plant Architecture in Rice. Plant Physiology, 2013, 161(1): 317-329
  2. 2.0 2.1 Li P, Wang Y, Qian Q, Fu Z, Wang M, Zeng D, Li B, Wang X, Li J(2007)LAZY1 controls rice shoot gravitropism through regulating polar auxin transport. Cell Res 17:402–410