Difference between revisions of "Os11g0104300"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Annotated Information)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
===NAME===
+
===Name===
 
''DWARF53''(''D53'')
 
''DWARF53''(''D53'')
  
===FUNCTION===
+
===Function===
 
''DWARF53''(''D53'') encodes a substrate of the SCF-D3 ubiquitination complex and functions as a repressor of SL signalling, whose hormone-induced degradation represents a key molecular link between SL perception and responses. D53 can interact with transcriptional co-repressors known as TOPLESS-RELATED PROTEINS.
 
''DWARF53''(''D53'') encodes a substrate of the SCF-D3 ubiquitination complex and functions as a repressor of SL signalling, whose hormone-induced degradation represents a key molecular link between SL perception and responses. D53 can interact with transcriptional co-repressors known as TOPLESS-RELATED PROTEINS.
  
===PHENOTYPE===
+
===Phenotype===
 
The rice (Oryza sativa) d53 mutant, which produces an exaggerated number of tillers compared to wild-type plants, is caused by a gain-of-function mutation and is insensitive to exogenous SL treatment.
 
The rice (Oryza sativa) d53 mutant, which produces an exaggerated number of tillers compared to wild-type plants, is caused by a gain-of-function mutation and is insensitive to exogenous SL treatment.
  
Line 15: Line 15:
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
The ''D53'' gene product shares predicted features with the class I Clp ATPase proteins and can form a complex with thea/bhydrolase protein DWARF 14 (D14) and the F-box protein DWARF 3 (D3), two previously identified signalling components potentially responsible for SL perception. In a D14- and D3-dependent manner, SLs induce D53 degradation by the proteasome and abrogate its activity in promoting axillary bud outgrowth.
  
 
===Evolution===
 
===Evolution===

Revision as of 05:50, 28 May 2014

Please input one-sentence summary here.

Annotated Information

Name

DWARF53D53)

Function

DWARF53D53) encodes a substrate of the SCF-D3 ubiquitination complex and functions as a repressor of SL signalling, whose hormone-induced degradation represents a key molecular link between SL perception and responses. D53 can interact with transcriptional co-repressors known as TOPLESS-RELATED PROTEINS.

Phenotype

The rice (Oryza sativa) d53 mutant, which produces an exaggerated number of tillers compared to wild-type plants, is caused by a gain-of-function mutation and is insensitive to exogenous SL treatment.


Phenotype of d53 mutant.jpg

Expression

The D53 gene product shares predicted features with the class I Clp ATPase proteins and can form a complex with thea/bhydrolase protein DWARF 14 (D14) and the F-box protein DWARF 3 (D3), two previously identified signalling components potentially responsible for SL perception. In a D14- and D3-dependent manner, SLs induce D53 degradation by the proteasome and abrogate its activity in promoting axillary bud outgrowth.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os11g0104300

Description

Clp, N terminal domain containing protein

Version

NM_001072059.2 GI:297611030 GeneID:4349543

Length

5140 bp

Definition

Oryza sativa Japonica Group Os11g0104300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:193178..198317

Sequence Coding Region

193383..194690

Expression

GEO Profiles:Os11g0104300

Genome Context

<gbrowseImage1> name=NC_008404:193178..198317 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:193178..198317 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcccactccggtggccgccgcgaggcagtgcctctcgccggccgccgtccccgccctcgacgccgccgtcgcctcctctcgccgccgcgcccacgcccagactacctccctccacctcatctcctccctcctcgccccgcccgcacctcccctcctccgcgacgccctcgcccgcgcccgcagcgccgcctactcaccccgcgtccagctcaaggccctcgacctctgcttcgccgtctccctcgacaggctcccctccgtctccgcatcctcctcctcctctggcgccgccgacgagccccccgtctccaactccctcatggccgccatcaagcgctcccaggccaaccagcgccgcaacccggacaccttccacttctatcaccaggccgccaccgcccagactcccgccgccgtcaaggtcgagctctcccacctcgtcctcgccatcctcgatgaccccgtcgtcagccgcgtcttcgccgaggccggattccgcagcggggacatcaagctcgccatcctccgcccggctccgcccatgccgctcctcggccgcctccccacgcgcacccgtccgccgcctctcttcctctgcagcttcgccgccgcggacgacgccgacgtcccttcgccggccgggaatctcgccggcgcgggggaggagaactgccgccgcatcgcggagatcctctcccgcggccgcaaccccatgctcgtcggcgtcggggccgcctccgccgccgacgacttcgcggccgcctccccgtatcgtatcatccatgtcgaccccaacaccatcgaccgctcagacctcggcgtggcggcggcaatggccagtgccacctccggcctcatcataagcatcggagacctcaagcagctggtccccgatgaggacgcggaggcgcaggagaaggggcggcgggtggtggcggaggtgacgcgagtgctggagacgcacagcaaggtcggccgcgtctgggtgatggggtggtcggcaacgtacgagacctacctcgccttcctctccaaattccccttggtcgacaaggattgggacctccagctgctgccaatcaccgcggtgcatgccgccgccaccgctggccctgctgctgctgctgctggactcatgcctccggcaaccactgttgctgccttctccaagccagctgcaaggtcaagccttttctcttctcttctcttcacttttgtatccatgaattctttatgcataagattttattaccatccatttgctgactgccgtgctttctttattgtcagaatgtttcttggatag</cdnaseq>

Protein Sequence

<aaseq>MPTPVAAARQCLSPAAVPALDAAVASSRRRAHAQTTSLHLISSL LAPPAPPLLRDALARARSAAYSPRVQLKALDLCFAVSLDRLPSVSASSSSSGAADEPP VSNSLMAAIKRSQANQRRNPDTFHFYHQAATAQTPAAVKVELSHLVLAILDDPVVSRV FAEAGFRSGDIKLAILRPAPPMPLLGRLPTRTRPPPLFLCSFAAADDADVPSPAGNLA GAGEENCRRIAEILSRGRNPMLVGVGAASAADDFAAASPYRIIHVDPNTIDRSDLGVA AAMASATSGLIISIGDLKQLVPDEDAEAQEKGRRVVAEVTRVLETHSKVGRVWVMGWS ATYETYLAFLSKFPLVDKDWDLQLLPITAVHAAATAGPAAAAAGLMPPATTVAAFSKP AARSSLFSSLLFTFVSMNSLCIRFYYHPFADCRAFFIVRMFLG</aaseq>

Gene Sequence

<dnaseqindica>206..1513#tcaattccttccttctttccatttattttcttttattttcccaagagaaagagggtgaggaggctccatccgcgaaaagctactcgaccaacccacctgccaccctgcactttccgttattctcatttcaaccctcgcattttttacactccgctccccatgccctgtgaaaactaattacaatccagtccttcaccggtcagcgatgcccactccggtggccgccgcgaggcagtgcctctcgccggccgccgtccccgccctcgacgccgccgtcgcctcctctcgccgccgcgcccacgcccagactacctccctccacctcatctcctccctcctcgccccgcccgcacctcccctcctccgcgacgccctcgcccgcgcccgcagcgccgcctactcaccccgcgtccagctcaaggccctcgacctctgcttcgccgtctccctcgacaggctcccctccgtctccgcatcctcctcctcctctggcgccgccgacgagccccccgtctccaactccctcatggccgccatcaagcgctcccaggccaaccagcgccgcaacccggacaccttccacttctatcaccaggccgccaccgcccagactcccgccgccgtcaaggtcgagctctcccacctcgtcctcgccatcctcgatgaccccgtcgtcagccgcgtcttcgccgaggccggattccgcagcggggacatcaagctcgccatcctccgcccggctccgcccatgccgctcctcggccgcctccccacgcgcacccgtccgccgcctctcttcctctgcagcttcgccgccgcggacgacgccgacgtcccttcgccggccgggaatctcgccggcgcgggggaggagaactgccgccgcatcgcggagatcctctcccgcggccgcaaccccatgctcgtcggcgtcggggccgcctccgccgccgacgacttcgcggccgcctccccgtatcgtatcatccatgtcgaccccaacaccatcgaccgctcagacctcggcgtggcggcggcaatggccagtgccacctccggcctcatcataagcatcggagacctcaagcagctggtccccgatgaggacgcggaggcgcaggagaaggggcggcgggtggtggcggaggtgacgcgagtgctggagacgcacagcaaggtcggccgcgtctgggtgatggggtggtcggcaacgtacgagacctacctcgccttcctctccaaattccccttggtcgacaaggattgggacctccagctgctgccaatcaccgcggtgcatgccgccgccaccgctggccctgctgctgctgctgctggactcatgcctccggcaaccactgttgctgccttctccaagccagctgcaaggtcaagccttttctcttctcttctcttcacttttgtatccatgaattctttatgcataagattttattaccatccatttgctgactgccgtgctttctttattgtcagaatgtttcttggatagtagtgtatctgattaggtgtgctagtacgatttgcttatgttctttactaatttcattttttttaagtgttgatttgtgtgctttgcccattgtatggatatttttttcaacttgtgcaattgatttagtgtactactgtaattagaagcagcataggttgttaaaaaggcataaatctagaaaggtttgttttcttccactgcattttttttaaaaatgtttttacacggtcaatgatgtacaaccgtttttgtttaatgcgatggttgagttatgttctaagtgccatgttactcctgttatgttcttgttgagttatgaccgattcagttctgttaagtacgacaggagttgctggaaattttctcttctcagaagtgggttcctaatgtgttgtcatcagaaccttccagaccaacttccttctagatgctctgctgttagtcactacctgtgttatttactgatttctcagctcttttttcttttttgcctttaggatatttaatgggattttcttcttataagccttttctctgtagtcctattcttgtaatatttttggattttattactacatatgtgtggccatgaaggagaggttctattgccggtgcagaatccatatgcatacacattttgaactgcttgataaagagagactaaagtgtaaaagtaaaataatacagcttgtgtactaagagatgcaatttcatggtaaaagagtggtgcttctgctgcagcacatctgttctttactgctgtaatgctcaaattgctgatagtttgggtcatatatgtgggcagagattatttgtcattaatatgtagtatcacctatagtgaattaccttgatgcatagggctagtgatttctgtcacaacatagtattgtatggcattttattcagctgtagaaatgttaatgcttaagcgttgctggtattaatgacaaagtgacatatacataactccaatataaagcaacgatatgcttgtgtcttgacctcatagtttcaaacttgttattgcagcttgatggactcctttgttccttttggaggctttctctgtgataactacgaagagaacagcctgacagcaaattcatgcccacaggccctgcggtgccagcagtgcaatgataaatatgagcaagaagttgcaactatcattagcgcaagtggcattacagctgaagaccatcaccagggaggtcttccttccctgctgcagaatggcagcatgatgggtcctaacaatggatttgatccagtcaaggtgtgaagctacctatgtcttttggaacatttatgttaagtactgaacgcagcaagcactgcttgttgatagatgaataatttttggtcgttggtataaaagatgcacagttttttttcagtgcaggctagagatgatcggatggtattgaattcaaaaatattgaatctacggaagaagtggaatgagtactgcctgcggctccaccaagaccaccagaggatcaacagagatccttacaaaccatttccgcgctatattggtgttcccactgacaaagaaagatcagcaaattcaagcaaaggttctgagtcagttggggttcaaaaggatgttattaaaccttgtgcggtgtctgctgtacattccagctcaactgcaaggcctatttcatctccatctgtcaccaacaaaagaaatgaagatcttgtattgaaccttcaagccaggcattccaagagtgatgaaaaccttcaagaaaggggcatgcaatcccaacatggcaccctgtcgaatgttgacaatccggatgatcatgtctcaccatcatctgctgcacctgtggaaactgacttggttttgggcacccctcgagagtgtagttcgaaaggttcaagttccacctgcagtaaacgtgtagaggattcagagaggtctgtccatctggtacccaagaaggtggatgatttaaatctgaagcatccacaactctctgttcaacctaattcctgctcctggagttccataaatgttgggaaaacatcacacagtacactacactcagtagcttcaggaggcttctctgcctttggccaatggcagaaacggtcacctcttgctgcacaaaattctgatctgagcaattacaagctacttgttgaacgcctgttcaaggtagttggaaggcaggaggaagccttgagtgctatttgtgaatccattgtgcggtgccggtcaacagagtcgcgccgtggtcctaacaggaatgacatctggttgtgttttcatggttctgacagcatggccaagaagagaatcgccgtggcacttgcagagctcatgcacggcagcaaagataacttgatttatctggacctaaaccttcaggattgggatgactccagtttcagagggaagactggcatagactgcattgtggagcagttgagcaagaaacggcaatctgttctcttccttgacaacattgatagagctgactgccttgttcaggatagtctatctgatgctattaagtctggcaggttccaagacatgcgaggcaaggtggttgacattaatgactcgattgtggttttgtcaagaagcatgatacagggcagcaaaaatgggttggaagagggcctttcattttctgaagaaaagattctggcaactcgcggacatcgactgaagatcctggttgaaccgggtagggcaatcaccagtggatgccctagtggtaaggtggtagtttccccaaggcattttctcaccaaaattcaagcatctttgtgctctggttccatcagcaagagaaagctcagtatttctgatgatcaggaaaagctacaagagtcgccaagcagttcaaagcgactgcacagaacatcgagtgtaccattcgacctgaacctccctgttgatgaagatgaaccccttgatgctgatgacgacagtagtagccatgaaaattcatatggcaacacagaaaaatccattgatgcccttttgcattcggttgatggatcaatcaactttaagccgtttgactttgataaacttgctgatgacatgctgcaggagttcagcaacatactcaggaaaaatctgggttctgagtgcatgttggagattgatgttggtgcaatggaacaaatacttgccgcagcatggaaatcagaggaggataggaaacctgtgccgacctggctggagcaggtttttgccaggagccttgacgagctgaagctcaagcgtaagcatgtgagtagctctacccttagactagtggcctgtgaggacacagtaccagcagtgaaaggagacggtttaggagttttgctcccgccaagaataattctagattgttgatgatattatctgtatagggatcgctgtaattatctgtagtccacaatagtatagcattatttgttggctaaataagctctagtctagctgatgcattgccttgggttctctaattagctactgccattactgtcatatcattttctacctcagggccttttccagatatatgggcatccgaatgtatattggttgtaactactatggattgtcaatatttgattgttctatatatacatggacacatggtgctc</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0104300, RefSeq:Os11g0104300