Os03g0237250

LPA1 regulates tiller angle and leaf angle by controlling the adaxial growth of tiller node and lamina joint.

Annotated Information

Function

Loose Plant Architecture1,the functional ortholog of the AtIDD15/SHOOT GRAVITROPISM5 (SGR5) gene in Arabidopsis (Arabidopsis thaliana),regulates tiller angle and leaf angle by controlling the adaxial growth of tiller node and lamina joint. LPA1 was also found to affect shoot gravitropism. LPA1 encodes a predicted 438-amino acid protein.Sequence analysis indicated that LPA1 is a typical Cys-2/His-2 zinc finger protein, belonging to the plant-specific IDD protein family,where it was also known as OsIDD14 . It is interesting that OsIDD12, OsIDD13, and OsIDD14/LPA1 are more similar to one another and divergent from the other 12 rice members, like AtIDD14,AtIDD15/SHOOT GRAVITROPISM5 (SGR5), and AtIDD16 among the 16 Arabidopsis (Arabidopsis thaliana) members , suggesting the specificity of the six proteins in the IDD protein family.LPA1 defines a novel subfamily of IDD proteins with distinct domains and motifs.

Mutation

Thelpa1 mutant was a naturally occurring mutant isolated from anindicavariety, Zhongxian3037. During both the vegetative and reproductive stages,lpa1 always exhibited loose plant architecture with larger tiller angle and leaf angle than those of the wild type (Fig.1, A and B).The tiller angle at heading date and found that the maximum angle was 17.3° inlpa1 but only 9.8° in the wild type (Fig. 1C). Careful observation showed that the large tiller angle of lpa1 was caused by the more symmetrical growth of the tiller node compared with the wild type (Fig. 1D).The leaf angles: each angle was larger in lpa1 than in the wild type, and this difference was more obvious in older leaves, where the maximum angle of the fourth leaf could reach up to 61.2° in lpa1 but only 27.4° in the wild type (Fig. 1E). This difference was further confirmed by the dynamic change observed in the newly developing leaf (Fig. 1F). Detailed examination revealed that the large leaf angle of lpa1 was caused by a more rapid elongation on the adaxial side of the lamina joint (Fig. 1, G and H).

In rice, the lazy1 mutant exhibits a tiller-spreading phenotype resulting from reduced shoot gravitropism . To examine whether lpa1 was also involved in the same process, we analyzed the gravity response of young seedlings. The result revealed that both light- and dark-grown mutant seedlings had a reduced gravity response and could not grow upright eventually (Fig. 2, A–C). However,lpa1roots showed a normal gravity response (Fig. 2D). These results indicated thatLPA1is only involved in shoot gravitropism in rice.

Expression

To investigate the effects of LOC_Os03g13400, an RNA interference (RNAi) vector and an overexpression (OE) vector driven by the cauliflower mosaic virus (CaMV) 35S promoter were constructed and transformed into Yandao8 (a wild-type japonicavariety with compact plant architecture). Most RNAi and OE transgenic plants showed loose and compact plant architectures with differing degrees, respectively, compared with Yandao8 (Fig. 4A), from which one typical RNAi plant and one typical OE plant were selected for detailed analysis. Following two generations of self-pollination, the RNAi and OE transgenic plants showed stable phenotypes. Detailed observation showed that both tiller angle and leaf angle increased in the RNAi plant but decreased in the OE plant (Fig. 4, B and C). Real-time PCR analysis showed that the expression level of LOC_Os03g13400 was down-regulated nearly 4-fold in the RNAi plant but up-regulated more than 20-fold in the OE plant (Fig. 4, D and E). Furthermore, the gravity response was also reduced in the RNAi seedlings (Fig. 4F). These results strongly confirmed that LOC_Os03g13400 is LPA1 and also showed that the transcription level of LPA1 is closely associated with rice plant architecture. Real-time PCR revealed thatLPA1 was highly expressed in the lamina joint and internodes, especially in young tissues. However, older tiller base also showed a high expression level equivalent to the young second internode (Fig. 5A). LPA1 was also moderately expressed in coleoptile, root, seedling, and panicle but was barely detectable in leaf blade and leaf sheath (Fig. 5A). The higher expression levels of LPA1 in the lamina joint and tiller node correspond well with the main phenotypes of the mutant.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

State Key Laboratory of Plant Genomics and Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China

References

<references>

Structured Information

Gene Name	Os03g0237250
Description	Zinc finger, C2H2-type domain containing protein
Version	NM_001186408.1 GI:297721946 GeneID:9270511
Length	837 bp
Definition	Oryza sativa Japonica Group Os03g0237250, complete gene.
Source	Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome	Chromosome 3
Location	Chromosome 3:7289669..7290505
Sequence Coding Region	7289669..7290246,7290328..7290505
Expression	GEO Profiles:Os03g0237250
Genome Context	<gbrowseImage1> name=NC_008396:7289669..7290505 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>
Gene Structure	<gbrowseImage2> name=NC_008396:7289669..7290505 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>
Coding Sequence	<cdnaseq>atggcactggtcaagagccaccaccaaatgttggcctcttcttccacctcgtcctcctcaccctcctcccagcagcagcagcctccaccgccggcgtcgaactcctccagcctcgccgccgccgccgccgaccagccctcccccgccaagcgcaagaggcgccctcccggcacgccagacccagatgcggaggtggtggcgctgtcgccgaggacgctgctggagtcggacaggtacgtgtgcgagatctgcgggcaggggttccagcgggagcagaacctgcagatgcaccggcgccggcacaaggtgccgtggcggctggtcaagcgccccgcggcggcgacggcggcggaggacggcggcgccgcgggtggcggcggcggcgccggcggcggcgcgggcggcggaggggcgcggaagcgcgtgttcgtgtgcccggagccgagctgcctccaccacgacccggcacacgcgctgggcgacctcgtcggcatcaagaagcacttccggcgcaagcacggcggccggcggcagtgggtgtgtgcccgctgcgccaagggctacgccgtccagtccgactacaaggcccacctcaagacctgcggcacccgcggccactcctgcgactgcggccgcgtcttctcccggtacgtacaccaccccctctcctcctcctcaaacctacgtagcgttcatggcggccggcgacgcatgcactactactactacgtacgaacgctaaccatccatgattag</cdnaseq>
Protein Sequence	<aaseq>MALVKSHHQMLASSSTSSSSPSSQQQQPPPPASNSSSLAAAAAD QPSPAKRKRRPPGTPDPDAEVVALSPRTLLESDRYVCEICGQGFQREQNLQMHRRRHK VPWRLVKRPAAATAAEDGGAAGGGGGAGGGAGGGGARKRVFVCPEPSCLHHDPAHALG DLVGIKKHFRRKHGGRRQWVCARCAKGYAVQSDYKAHLKTCGTRGHSCDCGRVFSRYV HHPLSSSSNLRSVHGGRRRMHYYYYVRTLTIHD</aaseq>
Gene Sequence	<dnaseqindica>260..837#1..178#atggcactggtcaagagccaccaccaaatgttggcctcttcttccacctcgtcctcctcaccctcctcccagcagcagcagcctccaccgccggcgtcgaactcctccagcctcgccgccgccgccgccgaccagccctcccccgccaagcgcaagaggcgccctcccggcacgccaggtacgtatatacgtatgtgttggagacattgataccatcatgcatgcatggtgttcgatcatggagcccgtgtgtacgtagacccagatgcggaggtggtggcgctgtcgccgaggacgctgctggagtcggacaggtacgtgtgcgagatctgcgggcaggggttccagcgggagcagaacctgcagatgcaccggcgccggcacaaggtgccgtggcggctggtcaagcgccccgcggcggcgacggcggcggaggacggcggcgccgcgggtggcggcggcggcgccggcggcggcgcgggcggcggaggggcgcggaagcgcgtgttcgtgtgcccggagccgagctgcctccaccacgacccggcacacgcgctgggcgacctcgtcggcatcaagaagcacttccggcgcaagcacggcggccggcggcagtgggtgtgtgcccgctgcgccaagggctacgccgtccagtccgactacaaggcccacctcaagacctgcggcacccgcggccactcctgcgactgcggccgcgtcttctcccggtacgtacaccaccccctctcctcctcctcaaacctacgtagcgttcatggcggccggcgacgcatgcactactactactacgtacgaacgctaaccatccatgattag</dnaseqindica>
External Link(s)	NCBI Gene:Os03g0237250, RefSeq:Os03g0237250