Difference between revisions of "AY986492"
| Line 27: | Line 27: | ||
AP = Chromosome 6:1558..1899| | AP = Chromosome 6:1558..1899| | ||
CDS = 1558..1899| | CDS = 1558..1899| | ||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
source=RiceChromosome06 | source=RiceChromosome06 | ||
preset=GeneLocation | preset=GeneLocation | ||
Revision as of 07:28, 28 May 2014
Contents
Function
Resistant and susceptible alleles of Xa27 encode identical proteins. However, expression of only the resistant allele occurs when a rice plant is challenged by bacteria harbouring avrXa27, whose product is a nuclear localized type-III effector. Induction of Xa27 occurs only in the immediate vicinity of infected tissue, whereas ectopic expression of Xa27 resulted in resistance to otherwise compatible strains of the pathogen. Thus Xa27 specificity towards incompatible pathogens involves the differential expression of the R gene in the presence of the AvrXa27 effector.
Expression
The Xa27(t) locus conferred a high level of resistance to 27 strains and moderate resistance to three strains. Resistance of the Xa27(t) gene was developmentally regulated in IRBB27 and showed semidominant or a dosage effect in the cv. CO39 genetic background. As a prelude to cloning Xa27(t), a molecular mapping strategy was employed with a large mapping population consisting of 3,875 gametes
Evolution
Induction of Xa27 occurs only in the immediate vicinity of infected tissue, whereas ectopic expression of Xa27 resulted in resistance to otherwise compatible strains of the pathogen. Thus Xa27 specificity towards incompatible pathogens involves the differential expression of the R gene in the presence of the AvrXa27 effector.
Structured Information
| Gene Name |
AY986492 |
|---|---|
| Description |
2361 bp DNA linear PLN 24-JUN-2005. |
| Definition |
Oryza sativa (indica cultivar-group) Xa27 (Xa27) gene, Xa27-IRBB27 allele, complete cds. |
| LocusTag |
{{{tag}}} |
| Ensembl Transcript ID |
{{{tid}}} |
| Ensembl Protein ID |
{{{pid}}} |
| Length |
2361 bp |
| Source |
Oryza sativa Indica Group ORGANISM Oryza sativa Indica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:1558..1899 |
| Sequence Coding Region |
1558..1899 |
| Genome Context |
{{{GCID}}} |
| Gene Structure |
{{{GSID}}} |
| Coding Sequence |
{{{CDNA}}} |
| Protein Sequence |
<aaseq>MADWAMHHYLLLANQQRHRALADVAVRRRQLLLDSGRVFMLLGA VILMHMLTTTGGGASSGCTRGAEPCVALLLWLLGAALAMLSLVAGRFPVLAAAIAEEL
GDHLLGGLWSL</aaseq>
|
| Gene Sequence |
<dnaseqindica>1 ctgcagctga accaaacagt tttagctcca tcgaagaaag gagttatact gattggaatg 61 ctctcacagt aaaaaaaaca aggaagtaga gctggatttt agacagttct acaagaagtt
121 agaactctac caaaattgga attttggatg atggtctttt aaaaactcga ttgcaggaat
181 aaaattttac ggcttgaaac ttacaaaatg attagaaaag ataacatgcc tcagcgattt
241 gtaaaaaagt gaacaaataa aaatctacaa taccactaaa ctattgcttt attttgggga
301 cattgcttac cattgaaaaa acaactaacc gtaaatacga acacccatat caaatatact
361 atcactgata aaataatcaa ttgtaaattc aagcacacat attagtatag tactttaact
421 cgattggata gaagaaacct aactaattta agctatgcct cacaacaaaa aggtataaat
481 tttttaaggc ttcttttttt ttcttgcgtt tgctagttta tgcttttaag atgtttatac
541 cttttactcc cctcattcac tgtttaaata caatgggaat tagtgaaatc aatgagagtt
601 caaacttcga aacactgaat acatgttatt ttggattgaa atcaaatcga atcagtcaaa
661 ttcaaatagg aggaggaaca taggcattct tcctttcttc agcgggcacc attgaattca
721 gatactgctt cgcctagtct ctgtccaaga ctccacattt tctgatggtg atggggaact
781 ctgaaactat aggaggaaga ataaaatgaa gaatgcagaa atgaatagta atttgtgttt
841 tttaattctt cttcaattcc accttaggat ccaacttcag tccaaatcca aagtaatgca
901 actgccacta gatcaggcta gagcttcaaa ttcaactcca aaaacctccg taaagtggca
961 cacacagagg aaaaatcctg gattcgtcac tgcccatcaa catctgcttt cgcctcccaa
1021 ttcctgcttt ctgaaatctg ctttcgccga attcatgcct tcttgaatta tgctttctta
1081 gaccctcttt agatgggact aaaactttta ctctctatca catcggatgt ttggacacta
1141 attataaata ttaaacgtag actattaata aaacccatct ataatcttgt attaattcgc
1201 gagacgaatc tattgagcct aattaatcca tgattagcct atgtgatgct ataataaaca
1261 ttctctaatt ataaattaat tgggcttaaa aaatttgtct cgcgtattag ctttcattta
1321 tataattagt tttataaata gtctatattt aatactctaa attagtgtct aaatacaggg
1381 actaaagtta agtcactgga tccaaacacc acctaaggtt ttcttgtgta cttgtgaatt
1441 gtggttgact acgactacta gtgctataaa tagaagaaga gacccataga gagcatcaga
1501 gcaaagtact cctaaaagac agccacacac actgagacac ccaagaagct gcctccaatg
1561 gcggattggg cgatgcacca ctacctccta ctagccaacc agcaacgcca ccgagccctc
1621 gccgacgtcg ccgtccgccg ccgccagctg ctcctcgact ccggccgcgt cttcatgctc
1681 ctcggcgccg tcatcctcat gcacatgctc accactaccg gcggcggagc atcgtccggc
1741 tgcacccgcg gcgccgaacc ttgcgtcgcc ctcctcctgt ggctgctcgg cgcggcgctc
1801 gccatgctgt cgctcgtcgc cggccgattc cccgttctcg ctgccgccat tgctgaggag
1861 ctcggtgatc acctgcttgg tggtctctgg tctctctagt tctcctccgt gtccggtggt
1921 catcttcttc tccgtgcttt tgctctggag ttgagtacgg atctgtgtgt actgcattct
1981 tgcttaatta gtgccctaca cgttatgctt tcgaaacatc atcttttttc agtatagttc
2041 aataaatttc agctcaaatt tgtcctccaa gacgagttct ccatccaaac gaaacttatg
2101 gtgttccgtt gtttgggccg attttatatg ttggaaatgt acagacttca tagtactgtg
2161 tttctttttt ggaataagtt caccagaggt tccttaactt aacggcgata tttttttagg
2221 tcctttaacc acaaaaccag aaatgtgcac ccctaaactt tcacaatccg tgcacaagag
2281 gtcctatggc agtatacgtg ggtggtttcg ctgacgtgac atcctagtca gcaaaaataa
2341 ataaataagt aagtggggcc c</dnaseqindica>
|
| External Link(s) |
{{{Link}}} |
Labs working on this gene
1. Temasek Life Sciences Laboratory, National University of Singapore, Singapore, 117604, Singapore
2. Rice Research Institute, Anhui Academy of Agricultural Sciences, Hefei, 230031, Anhui, China
2. Rice Research Institute, Anhui Academy of Agricultural Sciences, Hefei, 230031, Anhui, China
References
1. Yanchang Luo;Jatinder S. Sangha;Shouhai Wang;Zefu Li;Jianbo Yang;Zhongchao Yin
Marker-assisted breeding of Xa4, Xa21 and Xa27 in the restorer lines of hybrid rice for broad-spectrum and enhanced disease resistance to bacterial blight Molecular Breeding, 2012, 30(4): 1601-1610
2. Keyu Gu;Bing Yang;Dongsheng Tian;Lifang Wu;Dongjiang Wang;Chellamma Sreekala;Fan Yang;Zhaoqing Chu;Guo-Liang Wang;Frank F. White;Zhongchao Yin
R gene expression induced by a type-III effector triggers disease resistance in rice Nature, 2005, 435: 1122-1125
3. K.Gu;D.Tian;F.Yang;L.Wu;C.Sreekala;D.Wang;G.-L.Wang;Z.Yin
High-resolution genetic mapping of Xa27(t), a new bacterial blight resistance gene in rice, Oryza sativa L. Theoretical and Applied Genetics, 2004, 108(5): 800-807