Difference between revisions of "Os04g0301500"

From RiceWiki
Jump to: navigation, search
(Function)
(References)
Line 20: Line 20:
 
==References==
 
==References==
 
Please input cited references here.
 
Please input cited references here.
 +
Koji Miyamoto;Takafumi Shimizu;Susumu Mochizuki;Yoko Nishizawa;Eiichi Minami;Hideaki Nojiri;Hisakazu Yamane;Kazunori Okada
 +
  Stress-induced expression of the transcription factor RERJ1 is tightly regulated in response to jasmonic acid accumulation in rice
 +
  Protoplasma, 2013, 250(1): 241-249
  
 
==Structured Information==
 
==Structured Information==

Revision as of 08:43, 28 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. RERJ1, a JA-inducible transcription factor in rice, is up-regulated by exposure to wounding and drought stress.RERJ1 has self-activating ability. It is a upregulated genes in plants under the drought stress and the mechanical damage.And after mechanical damage, its expression is affected by a JA-dependent manner. RERJ1 only induced in place where mechanical damaged, but the drought make it expressed throughout the leaf area. Therefore, RERJ1 as a transcriptional activator can regulate gene expression induced by stress, and this stress related with JA accumulation areas.RERJ1 plays a role as a transcriptional activator for regulating stress-inducible gene expression, with a strong correlation to JA accumulation in the stressed region.

Expression

Please input expression information here. The expression of RERJ1 after wounding is regulated in a JA-dependent manner in rice. RERJ1 expression was induced only at the region of injury after wounding, whereas expression was induced in the entire leaf after drought. According to JA measurements of stressed leaves, high accumulation of endogenous JA was only detected around the wound site in a rice leaves, whereas the drought treatment led to uniform accumulation of JA in the entire leaf, suggesting that RERJ1will be a useful marker gene for studies on localization of JA in rice.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here. Koji Miyamoto;Takafumi Shimizu;Susumu Mochizuki;Yoko Nishizawa;Eiichi Minami;Hideaki Nojiri;Hisakazu Yamane;Kazunori Okada

 Stress-induced expression of the transcription factor RERJ1 is tightly regulated in response to jasmonic acid accumulation in rice
 Protoplasma, 2013, 250(1): 241-249

Structured Information

Gene Name

Os04g0301500

Description

Basic helix-loop-helix dimerisation region bHLH domain containing protein

Version

NM_001058941.1 GI:115457611 GeneID:4335417

Length

2402 bp

Definition

Oryza sativa Japonica Group Os04g0301500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:13515243..13517644

Sequence Coding Region

13515513..13515611,13516595..13517065,13517150..13517429,13517497..13517579

Expression

GEO Profiles:Os04g0301500

Genome Context

<gbrowseImage1> name=NC_008397:13515243..13517644 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:13515243..13517644 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggacgccgagatggccatgggcgagagcttcgcctactactgggagacgcagcgctaccttgagtccgaggagctcgacagcatgtacctgccgacgcaggatgactccaactacgagtcgagctcgccggacgggtcgcactcgtcgtcggcgccggcgccggcggccgtgggcggggacgcagccgccgcggtggcgggtagcggtggcgggatgacgacgatgatgatgggcggcggcggcggcggtggcgacgacgccggtggcgcgaacaagaacatcctcatggagcgcgaccgccgccgcaagctcaacgagaagctctacgcgctccgcagtgtcgtgcccaacatcaccaagatggacaaggcgtcgatcatcaaggacgcgatcgagtacatccagcgcctgcaggcggaggagcagcagatgctccgggaggtcgccgcgctcgagtccgccgccgcggcgagcgccgccccggccgcggcgaacccgttcgccggcctcggcgccgacgaggaacacgagtacggccaccaccacccctcgtcgtcgtcggagcggacgaagaaggtgaagcgggcgctgtccgtgtcgtccatcagcgacgccctgctcgccgcggcggcgccggcgccgccggtggagatccaggagctgcgcgtgtcggaggtgggcgacagggtgctggtggtgagcgtgacgtgcagcaagcgccgcgacgccatggcccgggtgtgccgcgccctcgaggagctccgcctccgcgtcatcaccgccaacatcacctccgtcgccggctgcctcatgcacaccctcttcgtcgaggtagatcacatggatagtgtccaaatgaagcagatggtggaggctgctctctcccagcttgtggcgaccggcagtccgttgagctccatgagctattag</cdnaseq>

Protein Sequence

<aaseq>MDAEMAMGESFAYYWETQRYLESEELDSMYLPTQDDSNYESSSP DGSHSSSAPAPAAVGGDAAAAVAGSGGGMTTMMMGGGGGGGDDAGGANKNILMERDRR RKLNEKLYALRSVVPNITKMDKASIIKDAIEYIQRLQAEEQQMLREVAALESAAAASA APAAANPFAGLGADEEHEYGHHHPSSSSERTKKVKRALSVSSISDALLAAAAPAPPVE IQELRVSEVGDRVLVVSVTCSKRRDAMARVCRALEELRLRVITANITSVAGCLMHTLF VEVDHMDSVQMKQMVEAALSQLVATGSPLSSMSY</aaseq>

Gene Sequence

<dnaseqindica>2034..2132#580..1050#216..495#66..148#gtcggagagagacacaagccaacctcgaactcgaagcagagcaaacgcgaagcagagcaagcgccatggacgccgagatggccatgggcgagagcttcgcctactactgggagacgcagcgctaccttgagtccgaggagctcgacaggtgcgcctccgcctcgccgccgccgccgatccgccattgttgttgctgacatggtgtttggttgcagcatgtacctgccgacgcaggatgactccaactacgagtcgagctcgccggacgggtcgcactcgtcgtcggcgccggcgccggcggccgtgggcggggacgcagccgccgcggtggcgggtagcggtggcgggatgacgacgatgatgatgggcggcggcggcggcggtggcgacgacgccggtggcgcgaacaagaacatcctcatggagcgcgaccgccgccgcaagctcaacgagaagctctacgcgctccgcagtgtcgtgcccaacatcaccaaggtaagggagagaggagtagaggtgttcgtccatggcggcgacggcgacattgctgactgactgctcgtcggtggttgggcgcagatggacaaggcgtcgatcatcaaggacgcgatcgagtacatccagcgcctgcaggcggaggagcagcagatgctccgggaggtcgccgcgctcgagtccgccgccgcggcgagcgccgccccggccgcggcgaacccgttcgccggcctcggcgccgacgaggaacacgagtacggccaccaccacccctcgtcgtcgtcggagcggacgaagaaggtgaagcgggcgctgtccgtgtcgtccatcagcgacgccctgctcgccgcggcggcgccggcgccgccggtggagatccaggagctgcgcgtgtcggaggtgggcgacagggtgctggtggtgagcgtgacgtgcagcaagcgccgcgacgccatggcccgggtgtgccgcgccctcgaggagctccgcctccgcgtcatcaccgccaacatcacctccgtcgccggctgcctcatgcacaccctcttcgtcgaggtataatacaatctccatctccattgctgacgtcacgcacgatcactgagctcctcttcctttccttaggtttgaccttccaagtttgactttgaccgttcacacgcagtactacattttacttccatttttaggtagaaaaataacgttgcgatcacacgctgctccctttgcggcgtcagtatgttaggccaatcaaatcctcaccaatcctaaagcaaccgtcccgaatctcaaagcatcagaaaatccccttctccccgctttacgaatccacctgattcttcttcttctgttcttcgattgcaaaaagcgattgaaaaccacatgggattaatcgggtgcgcacgagggagaaatcgaacaattcgatggatggatggatcgcgcacgtgcttcagataataattaatgaattaattttttgggggacaaacgggagcactacatctacatgggcgtcacatcacgtgcgtgttttggttgggggaagccatggaaaacgattggcacgtgttcgattgcacgggagatgatttttttcccctcgtttttttatttgttgtgacgttaaattccacacttttctttaagctgatttgattacagatgtgaagacaacagtttttgggggatgttctgtgttttgtcctcttctagaaattaggtgtttgatacacattattgaggccgagttagttttttttttttggggattgaggctgagttagtttgttgacttccacgtgcatgcacgtttcttgaactgttaaatttttaaaagaaattatacaaaaattgttttaaataaatcataacaatatattttttaagatttttaaaatatatttaattaatcatgtgttaatccattactctattttacgtgcggagggaaggggttcgcaacctcttcaaaagaacaaaaccttagcattgttaattttggggttttggctgaataaagttgtttcaaatttcaggtagatcacatggatagtgtccaaatgaagcagatggtggaggctgctctctcccagcttgtggcgaccggcagtccgttgagctccatgagctattagttatgagctggatagatatatggagtcatgcgttttggccacctactttacctagtctcattcgcaataaagcgcatttttatgtatgcttggtgatgttgttgttgtcatttttgcgacaccccactacgtgatggaggtggttgttttcttgcgaggcaacgatttagtggctggatgatagatttaagtattttggaaatcttgagtacgctgacttgtttatgtagctattaatattgatgaataataaggtggtccagcttaatg</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0301500, RefSeq:Os04g0301500