Difference between revisions of "Os10g0397400"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 19: Line 19:
  
 
==References==
 
==References==
*1.Zhi Hong;Miyako Ueguchi-Tanaka;Shozo Fujioka et al.The Rice brassinosteroid-deficient dwarf2 Mutant, Defective in the Rice Homolog of Arabidopsis DIMINUTO/DWARF1, Is Rescued by the Endogenously Accumulated Alternative Bioactive Brassinosteroid, Dolichosterone.''The Plant Cell'',2005,17(8):2243-2254
+
*1.Zhi Hong,Miyako Ueguchi-Tanaka,Shozo Fujioka et al.The Rice brassinosteroid-deficient dwarf2 Mutant, Defective in the Rice Homolog of Arabidopsis DIMINUTO/DWARF1, Is Rescued by the Endogenously Accumulated Alternative Bioactive Brassinosteroid, Dolichosterone.''The Plant Cell'',2005,17(8):2243-2254
 
*2.Tanaka,T., Antonio,B.A., Kikuchi,S. et al. The Rice Annotation Project Database (RAP-DB): 2008 update.''Nucleic Acids Res''.36 (DATABASE ISSUE),D1028-D1033(2008)
 
*2.Tanaka,T., Antonio,B.A., Kikuchi,S. et al. The Rice Annotation Project Database (RAP-DB): 2008 update.''Nucleic Acids Res''.36 (DATABASE ISSUE),D1028-D1033(2008)
 
*3.Itoh,T., Tanaka,T., Barrero,R.A. et al. Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana.''Genome Res''.17(2),175-183(2007)
 
*3.Itoh,T., Tanaka,T., Barrero,R.A. et al. Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana.''Genome Res''.17(2),175-183(2007)

Revision as of 11:07, 28 May 2014

Please input one-sentence summary here.

Annotated Information

Function

The rice (Oryza sativa) brassinosteroid (BR)-deficient dwarf2 (brd2) is a loss-of-function allele of Dim/dwf1, a gene homologous to the Arabidopsis DIM/DWF1.The gene brd2 mutation causes a semidwarf phenotype in the vegetative stage,with severe defects in internode elongation and panicle and seed development. Quantitative analysis of the endogenous sterol levels showed that brd2 is defective in the conversion of 24-MC to CR, as are the Arabidopsis dim/dwf1 and pea lkb mutants.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

  • BioScience and Biotechnology Center,Nagoya University,Chikusa,Nagoya 464-8601,Japan
  • RIKEN,Institute of Physical and Chemical Research,Wako-shi,Saitama 351-0198,Japan
  • Department of Chemistry,Joetsu University of Education,Joetsu-shi,Niigata 943-8512,Japan

References

  • 1.Zhi Hong,Miyako Ueguchi-Tanaka,Shozo Fujioka et al.The Rice brassinosteroid-deficient dwarf2 Mutant, Defective in the Rice Homolog of Arabidopsis DIMINUTO/DWARF1, Is Rescued by the Endogenously Accumulated Alternative Bioactive Brassinosteroid, Dolichosterone.The Plant Cell,2005,17(8):2243-2254
  • 2.Tanaka,T., Antonio,B.A., Kikuchi,S. et al. The Rice Annotation Project Database (RAP-DB): 2008 update.Nucleic Acids Res.36 (DATABASE ISSUE),D1028-D1033(2008)
  • 3.Itoh,T., Tanaka,T., Barrero,R.A. et al. Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana.Genome Res.17(2),175-183(2007)

Structured Information

Gene Name

Os10g0397400

Description

Similar to Cell elongation protein DIMINUTO (Cell elongation protein Dwarf1)

Version

NM_001071069.1 GI:115481881 GeneID:4348555

Length

1378 bp

Definition

Oryza sativa Japonica Group Os10g0397400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:13717033..13718410

Sequence Coding Region

13717336..13717779,13718034..13718408

Expression

GEO Profiles:Os10g0397400

Genome Context

<gbrowseImage1> name=NC_008403:13717033..13718410 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:13717033..13718410 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>gcttccaaagaagaggcaaagaagaagggcaataagatcaactgtgtcgggtggtggttcaagccttggttttaccaacatgctcagacagcactcaagaagggtgagtttgtggagtacattccaacaagagagtactaccaccgtcacacccggtgtctgtactgggaggggaagctgatcttgccattcggcgaccaattctggttcaggttcctcttgggctggctgatgccaccaaaggtgtctctgctcaaggccacacagggtgaatctatcaggaattactaccatgacaaccatgtgattcaagacatgctggttcccttgtacaaagttggagatgctcttgagtttgttcacaaggaaatggaggtttatccactgtggctgtgcccgcaccggctctacaagctccctgtgaaaaccatggtgtacccagagcctggctttgagcaccaccacaggcaaggtgacactagctatgcccagatgttcaccgatgttggtgtgtactatgctcctggtgctgtcctgaggggcgaggagttcaatggcgctctagctgtccacaggctggagcagtggctgattgagaaccacagctaccagccacagtacgctgtatctgagctcaacgagaaggacttctggaggatgtttgatgcttctcactacgagcattgccgccaaaagtatggtgccgtcggtacctttatgagcgtctactacaagtccaagaagggaaggaagactgagaaggaggtgcaggaagccgaggccgccatcctcgagccagcctacgctgatgaggcgtaa</cdnaseq>

Protein Sequence

<aaseq>ASKEEAKKKGNKINCVGWWFKPWFYQHAQTALKKGEFVEYIPTR EYYHRHTRCLYWEGKLILPFGDQFWFRFLLGWLMPPKVSLLKATQGESIRNYYHDNHV IQDMLVPLYKVGDALEFVHKEMEVYPLWLCPHRLYKLPVKTMVYPEPGFEHHHRQGDT SYAQMFTDVGVYYAPGAVLRGEEFNGALAVHRLEQWLIENHSYQPQYAVSELNEKDFW RMFDASHYEHCRQKYGAVGTFMSVYYKSKKGRKTEKEVQEAEAAILEPAYADEA</aaseq>

Gene Sequence

<dnaseqindica>632..1075#3..377#atgcttccaaagaagaggcaaagaagaagggcaataagatcaactgtgtcgggtggtggttcaagccttggttttaccaacatgctcagacagcactcaagaagggtgagtttgtggagtacattccaacaagagagtactaccaccgtcacacccggtgtctgtactgggaggggaagctgatcttgccattcggcgaccaattctggttcaggttcctcttgggctggctgatgccaccaaaggtgtctctgctcaaggccacacagggtgaatctatcaggaattactaccatgacaaccatgtgattcaagacatgctggttcccttgtacaaagttggagatgctcttgagtttgttcacaaggaaatggaggtgtgtttcacttcggatcgaatatttgatgtttaagtatcaaatatgcatttaaaacgaggcttttcaattatataactacttctagaaatgaatattccatgccataaattgttatgcttgcacatgcattctattacttatatctttgggcttgatgtaagttcacctaactattcttgtgcctgtaccaactattttagtgtactgcaatctactgctgcttacagttcactaataatttctgttattaggtttatccactgtggctgtgcccgcaccggctctacaagctccctgtgaaaaccatggtgtacccagagcctggctttgagcaccaccacaggcaaggtgacactagctatgcccagatgttcaccgatgttggtgtgtactatgctcctggtgctgtcctgaggggcgaggagttcaatggcgctctagctgtccacaggctggagcagtggctgattgagaaccacagctaccagccacagtacgctgtatctgagctcaacgagaaggacttctggaggatgtttgatgcttctcactacgagcattgccgccaaaagtatggtgccgtcggtacctttatgagcgtctactacaagtccaagaagggaaggaagactgagaaggaggtgcaggaagccgaggccgccatcctcgagccagcctacgctgatgaggcgtaatttcgttgagacctttgatggtttagtcgtccgggttttctccccattccaaatgggatttttcatctgaactatccttttgcttagaacttgatgtgcagtgtttgtagcactttgtaatcctgtcatcgtcgtccgtctgctcttggtacttctttcacccttgatcaagttgctgaacttagtcaggacttaagtggtatttaacccaagatctgaataattttgtggctactggactagttaatttcctcagctattaatttgagctgtagcatcagatgaggtgaactttagcaattg</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0397400, RefSeq:Os10g0397400