Difference between revisions of "Os01g0117600"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
This gene encodes a putative rust resistance kinase Lr10,  and its functions are unknown.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
This gene is characterized from the cultivar Nipponbare, and is postulated to encode a putative rust resistance kinase Lr10-like protein which belongs to <br />the protein kinase superfamily. Even though the functions of the gene are unknown, some functions can still be learned by homologous prediction. The <br />protein harbors Tyrosine potentiality, protein kinases by its PKc-like catalytic domain, and transferase activity. The protein also contains an <br />ATP-binding site and a substrate binding site.The Lr10-like protein is expressed to resist the infectious agent Magnaporthe grisea, also known as rice<br /> blast fungus. This fungus can cause causes a serious disease affecting rice,such as rice rotten neck, rice seedling blight and blast of rice[1].
 +
 
 +
... Figure1  Rice blast[2]
 +
    [[File:riceblast.jpeg|caption]]
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
The rice gene corresponding to Lr10 was mapped on rice chromosome 1, where it occurred in many copies[3]. The Lr10-like protein is expressed in the<br /> rice leaf, and the expresssion is regulated by a complex signal pathway net[4]. However, the regulation mechanism of LR-10 expression in rice is still <br />poorly known.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
The Lr-10 belong to a superfamily including over 50 members. The Lr10 gene originates from hexaploid wheat and is located on chromosome 1AS[4]. The<br /> Lr1 and Lr9 resistance gene in wheat is intensively researched, but the evolution is still in blank.
 +
 
  
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Line 17: Line 20:
  
 
==References==
 
==References==
Please input cited references here.
+
[1]http://en.wikipedia.org/wiki/Magnaporthe_grisea#cite_note-5 .[[http://en.wikipedia.org/wiki/Magnaporthe_grisea#cite_note-5]]
 +
 
 +
[2]http://www.oisat.org/pests/diseases/fungal/rice_blast.html.  [[http://www.oisat.org/pests/diseases/fungal/rice_blast.html]]
 +
 
 +
[3]Gallego F, Feuillet C, Messmer M, ''et al''.Comparative mapping of the two wheat leaf rust resistance loci Lr1 and Lr10 in rice and barley. Genome.1998 Jun;41(3):328-36.[PMID: 9729767] [[PMID: 9729767]]
 +
 
 +
[4]Catherine Feuillet, Silvia Travella, Nils Stein,et al.Map-based isolation of the leaf rust disease resistance gene Lr10 from the hexaploid wheat (Triticum aestivum L.) genome. PNAS.2003; 100(25): 15253–15258.PMCID: PMC299976. [doi:  10.1073/pnas.2435133100]
 +
 
  
 
==Structured Information==
 
==Structured Information==

Revision as of 11:26, 28 May 2014

This gene encodes a putative rust resistance kinase Lr10, and its functions are unknown.

Annotated Information

Function

This gene is characterized from the cultivar Nipponbare, and is postulated to encode a putative rust resistance kinase Lr10-like protein which belongs to
the protein kinase superfamily. Even though the functions of the gene are unknown, some functions can still be learned by homologous prediction. The
protein harbors Tyrosine potentiality, protein kinases by its PKc-like catalytic domain, and transferase activity. The protein also contains an
ATP-binding site and a substrate binding site.The Lr10-like protein is expressed to resist the infectious agent Magnaporthe grisea, also known as rice
blast fungus. This fungus can cause causes a serious disease affecting rice,such as rice rotten neck, rice seedling blight and blast of rice[1].

... Figure1 Rice blast[2]

   caption

Expression

The rice gene corresponding to Lr10 was mapped on rice chromosome 1, where it occurred in many copies[3]. The Lr10-like protein is expressed in the
rice leaf, and the expresssion is regulated by a complex signal pathway net[4]. However, the regulation mechanism of LR-10 expression in rice is still
poorly known.

Evolution

The Lr-10 belong to a superfamily including over 50 members. The Lr10 gene originates from hexaploid wheat and is located on chromosome 1AS[4]. The
Lr1 and Lr9 resistance gene in wheat is intensively researched, but the evolution is still in blank.


Labs working on this gene

Please input related labs here.

References

[1]http://en.wikipedia.org/wiki/Magnaporthe_grisea#cite_note-5 .[[1]]

[2]http://www.oisat.org/pests/diseases/fungal/rice_blast.html. [[2]]

[3]Gallego F, Feuillet C, Messmer M, et al.Comparative mapping of the two wheat leaf rust resistance loci Lr1 and Lr10 in rice and barley. Genome.1998 Jun;41(3):328-36.[PMID: 9729767] PMID: 9729767

[4]Catherine Feuillet, Silvia Travella, Nils Stein,et al.Map-based isolation of the leaf rust disease resistance gene Lr10 from the hexaploid wheat (Triticum aestivum L.) genome. PNAS.2003; 100(25): 15253–15258.PMCID: PMC299976. [doi: 10.1073/pnas.2435133100]


Structured Information

Gene Name

Os01g0117600

Description

Protein kinase-like domain containing protein

Version

NM_001048388.1 GI:115434189 GeneID:4326070

Length

2551 bp

Definition

Oryza sativa Japonica Group Os01g0117600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:993712..996262

Sequence Coding Region

993910..995048,995153..995322,995412..996223

Expression

GEO Profiles:Os01g0117600

Genome Context

<gbrowseImage1> name=NC_008394:993712..996262 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:993712..996262 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgaaatccaatgcatctcgtgcttctgccactcgtagaaagttctacttcttgcagaaatctctgcttgtctcttctttgcttgcggttgttgcagcagatgttgttggagcagggccaaaccagcagtgttttccttcctcctgtggtgatcttggcaacatatcctaccctttccgtcttgcaagcgattcacgcccgtgcgttggtactcttcgcccatggtacaacctctcatgtagcagtggcagggctaccattcagatcaacacacggacgtactatgtcaccagcatcaactatactggtgagatcttctcggttgtggatgccaccttgcaggatgatgatacaaacggcaccagctgccctcttcctcgctctgatcaccttccttacatcgattactggcctccgtatttgggggaaagttcaaccgattcttatggttttgtctatttggccactgcttcagacacttgggcatgctttgtgaattgttcccgagcaagaacagatactatgccctggtacaggccagttacatgtctacttcccaacaattcatttgtttttgtctcgtttgatgactgtgccgttggagagcttcaaccttcctgtcgatatttggccatgattcccgttgacagatggaatctaccggacaactcctcacagctacagaatgcaagttacacagatatcataggattcataaggaaaggatttagtgttcggtttccatatcgtcctgaccagtaccagagtcctcgtatgagcgccagggaatgcctgaaggattcaaacaggtacttcaaggagcgtatatctcatccaagcattctgaatttaacccgtgctattttctggagcgaaacaaactccgaagtagactgcggatatgaagttgccccccaaaaagataggatttttttgggaaccatagtatcggctattgatatcatcaaatttcatttcgttttattcaggttagtgttggggtcactggtggtattcatcttccttgcccacaagtactggaaaacaaggatcacgatcgacgcagtagagaagttccttcgaatgcagcagatgattggtccgacgaggtttgcctacacagacattattgcaatcacatcccattttcgagacaagctaggccagggaggctatggctctgtatataaaggtgtactgctcccgggtaatgtccatatcgctgtcaagatgctgactggtagctccagctgcaacggagatgagttcatcagtgaggtctcaaccattggaaggattcaccatgtcaatgtggtgcgtctggtcgggttttgctctgaagaaatgaggagggcacttgtgtacgagtacatgcctcgaggctctcttgacaagtacatcttctcgtcagagaagagtttctcctgggataagctgaatgagatcgctttgggcattgcaagagggatcaactacctgcatcagggctgcgagatgcagattctgcactttgacattaaacctcacaacatccttcttgacgataactttgtcccaaaggttgctgatttcggtcttgcgaagctatacccaagggataagagcttcgtccctgtgagcgctgcacgaggaaccgtgggctacatagctcccgagatgatctctcggagcttcggtgtcatatcaagcaaatccgatgtttatagcttcggaatgctactattggagatggctggaggaagaaggaatgcagatccaaatgcagcaaactcaagtcaagcttattatccatcacgggtgtacagggagctgactcggcgagaaacaagcgagatctctgacattgctgatatgcatgaactagagaagaagctttgcattgttggattgtggtgcattcagatgaggtcatgtgatcgaccgacgatgagcgaggtgatagagatgcttgaaggtggcagtgatgaactgcaggttcctccaaggccattcttctgtgatgatgagcaattccctggagtggagtcttacaatatgccatctgatctaactgcaatctccgaggagcatgaggacgacgacgacgaaagcatatgtctgttcgaaagctaccagtaa</cdnaseq>

Protein Sequence

<aaseq>MAKSNASRASATRRKFYFLQKSLLVSSLLAVVAADVVGAGPNQQ CFPSSCGDLGNISYPFRLASDSRPCVGTLRPWYNLSCSSGRATIQINTRTYYVTSINY TGEIFSVVDATLQDDDTNGTSCPLPRSDHLPYIDYWPPYLGESSTDSYGFVYLATASD TWACFVNCSRARTDTMPWYRPVTCLLPNNSFVFVSFDDCAVGELQPSCRYLAMIPVDR WNLPDNSSQLQNASYTDIIGFIRKGFSVRFPYRPDQYQSPRMSARECLKDSNRYFKER ISHPSILNLTRAIFWSETNSEVDCGYEVAPQKDRIFLGTIVSAIDIIKFHFVLFRLVL GSLVVFIFLAHKYWKTRITIDAVEKFLRMQQMIGPTRFAYTDIIAITSHFRDKLGQGG YGSVYKGVLLPGNVHIAVKMLTGSSSCNGDEFISEVSTIGRIHHVNVVRLVGFCSEEM RRALVYEYMPRGSLDKYIFSSEKSFSWDKLNEIALGIARGINYLHQGCEMQILHFDIK PHNILLDDNFVPKVADFGLAKLYPRDKSFVPVSAARGTVGYIAPEMISRSFGVISSKS DVYSFGMLLLEMAGGRRNADPNAANSSQAYYPSRVYRELTRRETSEISDIADMHELEK KLCIVGLWCIQMRSCDRPTMSEVIEMLEGGSDELQVPPRPFFCDDEQFPGVESYNMPS DLTAISEEHEDDDDESICLFESYQ</aaseq>

Gene Sequence

<dnaseqindica>1215..2353#941..1110#40..851#atactactcggcaaggcaaatcctgccagactgggagccatggcgaaatccaatgcatctcgtgcttctgccactcgtagaaagttctacttcttgcagaaatctctgcttgtctcttctttgcttgcggttgttgcagcagatgttgttggagcagggccaaaccagcagtgttttccttcctcctgtggtgatcttggcaacatatcctaccctttccgtcttgcaagcgattcacgcccgtgcgttggtactcttcgcccatggtacaacctctcatgtagcagtggcagggctaccattcagatcaacacacggacgtactatgtcaccagcatcaactatactggtgagatcttctcggttgtggatgccaccttgcaggatgatgatacaaacggcaccagctgccctcttcctcgctctgatcaccttccttacatcgattactggcctccgtatttgggggaaagttcaaccgattcttatggttttgtctatttggccactgcttcagacacttgggcatgctttgtgaattgttcccgagcaagaacagatactatgccctggtacaggccagttacatgtctacttcccaacaattcatttgtttttgtctcgtttgatgactgtgccgttggagagcttcaaccttcctgtcgatatttggccatgattcccgttgacagatggaatctaccggacaactcctcacagctacagaatgcaagttacacagatatcataggattcataaggaaaggatttagtgttcggtttccatatcgtcctgaccagtaccagagtcctcgtatgagcgccagggaatgcctgaaggattcaaacaggttttttttcctcatgattctgtctatataaaaaagacgtgttcccttctcacttattaccccgtcttgtacaacggtgtgatttgcaggtacttcaaggagcgtatatctcatccaagcattctgaatttaacccgtgctattttctggagcgaaacaaactccgaagtagactgcggatatgaagttgccccccaaaaagataggatttttttgggaaccatagtatcggctattgatatcatcaaatttcatttcggtacgtacgaattacttgcttttaatcatcccatccgtgatattatgcgcgtctgaacatatatattctaacttatatacatgcatgttggtttgtttgagaagttttattcaggttagtgttggggtcactggtggtattcatcttccttgcccacaagtactggaaaacaaggatcacgatcgacgcagtagagaagttccttcgaatgcagcagatgattggtccgacgaggtttgcctacacagacattattgcaatcacatcccattttcgagacaagctaggccagggaggctatggctctgtatataaaggtgtactgctcccgggtaatgtccatatcgctgtcaagatgctgactggtagctccagctgcaacggagatgagttcatcagtgaggtctcaaccattggaaggattcaccatgtcaatgtggtgcgtctggtcgggttttgctctgaagaaatgaggagggcacttgtgtacgagtacatgcctcgaggctctcttgacaagtacatcttctcgtcagagaagagtttctcctgggataagctgaatgagatcgctttgggcattgcaagagggatcaactacctgcatcagggctgcgagatgcagattctgcactttgacattaaacctcacaacatccttcttgacgataactttgtcccaaaggttgctgatttcggtcttgcgaagctatacccaagggataagagcttcgtccctgtgagcgctgcacgaggaaccgtgggctacatagctcccgagatgatctctcggagcttcggtgtcatatcaagcaaatccgatgtttatagcttcggaatgctactattggagatggctggaggaagaaggaatgcagatccaaatgcagcaaactcaagtcaagcttattatccatcacgggtgtacagggagctgactcggcgagaaacaagcgagatctctgacattgctgatatgcatgaactagagaagaagctttgcattgttggattgtggtgcattcagatgaggtcatgtgatcgaccgacgatgagcgaggtgatagagatgcttgaaggtggcagtgatgaactgcaggttcctccaaggccattcttctgtgatgatgagcaattccctggagtggagtcttacaatatgccatctgatctaactgcaatctccgaggagcatgaggacgacgacgacgaaagcatatgtctgttcgaaagctaccagtaacttagtagcaagtacatttatgatgattgtttttacttaatttgtatgcccgttttgctgtctaaagttcaaatatgctgagatcgatatagtttttatgtttattgtaagtttgtagcacatataataaagtgagagcttgtaatatttaggagtgtatgcttaatctccacaagacagtattatgaataatcttct</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0117600, RefSeq:Os01g0117600