Difference between revisions of "Os02g0115900"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(References)
Line 22: Line 22:
 
==References==
 
==References==
 
1.Chang-Jin Park; Rebecca Bart; Mawsheng Chern; Patrick E. Canlas; Wei Bai; Pamela C. Ronald.Overexpression of the Endoplasmic Reticulum Chaperone BiP3 Regulates XA21-Mediated Innate Immunity in Rice.PLoS ONE, 2010, 5(2): e9262.
 
1.Chang-Jin Park; Rebecca Bart; Mawsheng Chern; Patrick E. Canlas; Wei Bai; Pamela C. Ronald.Overexpression of the Endoplasmic Reticulum Chaperone BiP3 Regulates XA21-Mediated Innate Immunity in Rice.PLoS ONE, 2010, 5(2): e9262.
 +
 
2.Yuhya Wakasa; Hiroshi Yasuda; Youko Oono; Taiji Kawakatsu; Sakiko Hirose; Hideyuki Takahashi; Shimpei Hayashi; Lijun Yang; Fumio Takaiwa.Expression of ER quality control-related genes in response to changes in BiP1 levels in developing rice endosperm.The Plant Journal, 2011, 65(5): 675-689.
 
2.Yuhya Wakasa; Hiroshi Yasuda; Youko Oono; Taiji Kawakatsu; Sakiko Hirose; Hideyuki Takahashi; Shimpei Hayashi; Lijun Yang; Fumio Takaiwa.Expression of ER quality control-related genes in response to changes in BiP1 levels in developing rice endosperm.The Plant Journal, 2011, 65(5): 675-689.
  

Revision as of 12:41, 28 May 2014

OsBip1,also named BiP3,has functions to assist folding seed storage proteins and has effect on seed phenotype,seed starch and protein accumulation

Annotated Information

Function

Binding protein (BiP) is enssential in folding of secretory proteins. Bip has a function in folding seed storage proteins in the ER lumen. OsBip1 reported by Park and his colleagues and BiP3 reported by Wakasa,Yasuda,et al are the same gene. In rice overpressing BiP1 , XA21-mediated immunity is compromised, XA21 stability is significantly decreased, and XA21 proteolytic cleavage is inhibited. Meanwhile,Wakasa,Yasuda, et al believe that severe suppression (BiP1 KD) or significant over-expression (BiP1 OEmax) of BiP1 can alter seed phenotype and the intracellular structure of endosperm cells and reduce seed storage protein content, starch accumulation and grain weight.

Expression

1. Researchers conclude that the peptides from the 140 kDa proteins can match XA21 from the N-terminal LRR region to the C-terminal kinase domain.However,the peptides from the 110 kDa protein match the LRR, but not the kinase domain. 2.Gene BiP3,predicted to encode a 666 amino acid protein with a molecular mass of 73.4 kDa ,has a 1,998 bp open reading frame which consists of 7 introns and 8 exons.In overall structure,BiP3 is similar to other known HSP70s in plants and animals.It has an approximately 45 kDa domain at the N-terminus that is predicted to have ATPase activity and a domain of approximately 25 kDa at the C-terminus having a predicted substrate-binding domain.

Evolution

1.BiP is one of the major ER chaperones and belongs to the heat shock protein 70 (HSP70) family.Rice BiP3 (OsBiP3) shows the greatest similarity to ArabidopsisBiP1 and BiP2 with 89.2% and 89.3% identity. 2.BiP with an ATPase domain at its N-terminus and a protein-binding domain at its C-terminus allows BiP to cycle between ATP hydrolysis and ADP exchange, and it is coupled to binding and release of the unfolded protein. 3.BiP protein has a KDEL ER retention signal at the C-terminus and is retained in the ER lumen. BiP interacts with nascent immature secretory proteins synthesized from membrane-bound polysomes on the ER,and assists in protein folding in concert with other chaperones and folding helpers such as calnexin and protein disulfide isomerase-like proteins in the ER lumen. BiP not only participates in assistence of protein folding but also take part in the protein degradation process known as ER-associated degradation. 4.Scientists reported that over-expression of BiP1 (Os02g0115900) in transgenic rice seed resulted in an opaque phenotype and abnormal intracellular structure.

Labs working on this gene

Transgenic Crop Research and Development Center, National Institute of Agrobiological Sciences; Department of Plant Pathology, University of California Davis

References

1.Chang-Jin Park; Rebecca Bart; Mawsheng Chern; Patrick E. Canlas; Wei Bai; Pamela C. Ronald.Overexpression of the Endoplasmic Reticulum Chaperone BiP3 Regulates XA21-Mediated Innate Immunity in Rice.PLoS ONE, 2010, 5(2): e9262.

2.Yuhya Wakasa; Hiroshi Yasuda; Youko Oono; Taiji Kawakatsu; Sakiko Hirose; Hideyuki Takahashi; Shimpei Hayashi; Lijun Yang; Fumio Takaiwa.Expression of ER quality control-related genes in response to changes in BiP1 levels in developing rice endosperm.The Plant Journal, 2011, 65(5): 675-689.

Structured Information

Gene Name

Os02g0115900

Description

Endosperm lumenal binding protein

Version

NM_001052210.1 GI:115443790 GeneID:4328075

Length

3896 bp

Definition

Oryza sativa Japonica Group Os02g0115900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:838743..842638

Sequence Coding Region

839048..839552,839638..839720,839828..839982,840078..840557,840855..841097
,841189..841403,841489..841756,842477..842525

Expression

GEO Profiles:Os02g0115900

Genome Context

<gbrowseImage1> name=NC_008395:838743..842638 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:838743..842638 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggatcgggttcgcggatgcgcgttcctgctcggcgtcctgctcgcaggatccctgtttgcattttctgttgcgaaggaggagaccaagaagctcggtaccgtgatcggtattgatcttggtacaacctactcgtgtgtcggtgtgtacaagaatggtcatgtcgagattatcgccaatgaccagggtaaccgtatcacaccctcatgggttgcattcaccgatagcgagaggctcatcggtgaggctgccaagaaccaggcagctgtgaacccagagaggaccatcttcgatgtcaaacgtctcattggaagaaagtttgaagacaaggaagttcagagggacatgaaacttgtcccctacaagattgtgaacaaggacggtaagccctacattcaggtcaagatcaaggatggagagaacaaggtcttcagccctgaggaggtcagtgctatgatccttggaaagatgaaggagactgctgaggcataccttggcaagaagatcaacgatgctgtcgtgactgttcctgcgtacttcaatgacgcgcagaggcaggcaaccaaggatgccggtgtcattgctggcctgaatgttgctaggatcatcaatgagccaactgctgctgctattgcgtacggtttggacaagaagggtggtgagaagaacatccttgtctttgaccttggtggtgggacattcgatgtcagtatcttgaccattgacaacggtgtgtttgaggtgttggccaccaatggtgacactcatcttggaggtgaggactttgaccagagaatcatggagtacttcatcaagttgatcaagaagaagtacagcaaggacatcagcaaggacaaccgtgctcttggaaagctgaggagggaagctgagcgtgccaagagggccctcagcaaccagcaccaggtccgtgttgagattgagtccctctttgacgggaccgatttctcggagccgctgacccgtgccagatttgaggagttgaacaatgatctgttccgcaagaccatgggacctgtcaagaaggctatggacgatgctggccttgagaagagccagattcatgagattgttcttgtcggtggtagcaccaggattcccaaggttcagcagctcctcagagactacttcgagggcaaggagcccaacaagggtgtcaaccctgatgaggctgttgcctatggtgctgcggttcagggaagcattctcagcggcgagggcggtgacgaaaccaaagatatccttctcctggatgtggcaccccttaccctcggtatcgagactgtcggtggagtcatgaccaagttgatccccaggaacaccgtcatccccaccaagaagtcccaggtgttcaccacctaccaggatcagcagacaaccgtctccatccaggtctttgagggtgagcgcagcatgaccaaggactgccgtcttctcggcaagttcgacctatctggcattccagcagcaccaaggggcaccccccagattgaggtgaccttcgaggtggacgccaacggcatcctgaacgtgaaggctgaggacaagggcaccggcaagtcggagaagatcacgatcacgaacgagaaggggcgcctgagccaggaggagatcgaccggatggtgcgcgaggcggaggagtttgcggaggaggacaagaaggtgaaggagcggatcgacgcccgcaaccagctcgagacctacgtgtacaacatgaagaacaccgtcggcgacaaggacaagctggcggacaagctggagagcgaggagaaggagaaggtggaggaggccctcaaggaggccctcgagtggctggacgagaaccagaccgccgagaaggaggagtacgaggagaagctcaaggaggtcgaggccgtctgcaaccccatcatctccgccgtctaccagaggaccggtggcgccccgggtggcggcgccgacggcgagggcggcgtcgacgacgagcatgacgagctgtag</cdnaseq>

Protein Sequence

<aaseq>MDRVRGCAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTY SCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRL IGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGENKVFSPEEVSAMILGKMKET AEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKK GGEKNILVFDLGGGTFDVSILTIDNGVFEVLATNGDTHLGGEDFDQRIMEYFIKLIKK KYSKDISKDNRALGKLRREAERAKRALSNQHQVRVEIESLFDGTDFSEPLTRARFEEL NNDLFRKTMGPVKKAMDDAGLEKSQIHEIVLVGGSTRIPKVQQLLRDYFEGKEPNKGV NPDEAVAYGAAVQGSILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIP TKKSQVFTTYQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPAAPRGTPQIEVTFE VDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERID ARNQLETYVYNMKNTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTAEKEEYEE KLKEVEAVCNPIISAVYQRTGGAPGGGADGEGGVDDEHDEL</aaseq>

Gene Sequence

<dnaseqindica>3087..3591#2919..3001#2657..2811#2082..2561#1542..1784#1236..1450#883..1150#114..162#acttgaaggttttcggatcgcaacccaaactcgcacaagggagaagagaagagaagcttcgagagagaggtggaggaggagacgagcgcgtggtggtggtggtgttggcggcgatggatcgggttcgcggatgcgcgttcctgctcggcgtcctgctcgcaggtgcgatctccccgttcctcgtttggatctgtgcttgcgcgcgcttagatttgtctatttgatgttgtgctggagttcgatctaagatgggctgtgaatgttcgttccactggatcacggatccgggagtagtttttttttttctcaacgagatggtccggtaaatggttttagagtgacactgatggatcgtatggatcgtggtagttagttaggagatatttgatatttgttttttttgtactacttcacaaattgaggtgcgattaaacttagatgccaccaataggtgaaggcggcgagtctggcgactccaagaaatatgtgatctggggtttatttatgatttatcctagtagtgctcagtgattttgttggaattcgtttgttagatactggtttaattgcagtgatgccatgatctgtcctgtgcattggtagcggtagagtttttaccttcacaattatgctgaatatgctagtagtaaaatatttctagggcaacactgaatagtttagaggcgcaaaatgtgctagaatggcatgaatgaaacgggctgcctagattttcaccttagaaacttacttggtctcataattcatgttactgttttaaaatcacatgaattatatgcctgtgtatatgtgtgccaatacacgataaatggtgaattgatagaacatgtagcttacatactgccactgctcctctgtttgcaggatccctgtttgcattttctgttgcgaaggaggagaccaagaagctcggtaccgtgatcggtattgatcttggtacaacctactcgtgtgtcggtgtgtacaagaatggtcatgtcgagattatcgccaatgaccagggtaaccgtatcacaccctcatgggttgcattcaccgatagcgagaggctcatcggtgaggctgccaagaaccaggcagctgtgaacccagagaggaccatcttcgatgtcaaacgtctcattggaagaaagtaatggcactttaccctatgctcgctcttatttcctgttgttgatcactgctgcctgatctgacctgtataattattcttgcaggtttgaagacaaggaagttcagagggacatgaaacttgtcccctacaagattgtgaacaaggacggtaagccctacattcaggtcaagatcaaggatggagagaacaaggtcttcagccctgaggaggtcagtgctatgatccttggaaagatgaaggagactgctgaggcataccttggcaagaagatcaacgatgctgtcgtgactgttcctggttagtaatgacaagacattcatgtgcttagttaactcaagcggtgattctgtggaagccattgctcacttctgctctttcatgttttcagcgtacttcaatgacgcgcagaggcaggcaaccaaggatgccggtgtcattgctggcctgaatgttgctaggatcatcaatgagccaactgctgctgctattgcgtacggtttggacaagaagggtggtgagaagaacatccttgtctttgaccttggtggtgggacattcgatgtcagtatcttgaccattgacaacggtgtgtttgaggtgttggccaccaatggtgacactcatcttggaggtatgactgcttttatttgcccttaggtactaaatatctgcttctgtacaacatcacagttgtagagtactgtagtttgattcaatgattttcatgcaacacatcatggtaaattggttatcttatacctgcacattctcattagacttttcagtaaaggcacgctgtcttttagaagattggcactattcatttgcttttaaactaatgacatgccttttgtagttagttggtcgtcttgattatctggatagtgcactgtgattcatatttgactgaactgtctcatctcttcaggtgaggactttgaccagagaatcatggagtacttcatcaagttgatcaagaagaagtacagcaaggacatcagcaaggacaaccgtgctcttggaaagctgaggagggaagctgagcgtgccaagagggccctcagcaaccagcaccaggtccgtgttgagattgagtccctctttgacgggaccgatttctcggagccgctgacccgtgccagatttgaggagttgaacaatgatctgttccgcaagaccatgggacctgtcaagaaggctatggacgatgctggccttgagaagagccagattcatgagattgttcttgtcggtggtagcaccaggattcccaaggttcagcagctcctcagagactacttcgagggcaaggagcccaacaagggtgtcaaccctgatgaggctgttgcctatggtgctgcggttcagggaagcattctcagcggcgagggcggtgacgaaaccaaaggttcgaccttgatcacatacatagtcctttgggttggtaacaactgcgatcatctgtcttgcatatacttatcgtgctttgattttggtacgcagatatccttctcctggatgtggcaccccttaccctcggtatcgagactgtcggtggagtcatgaccaagttgatccccaggaacaccgtcatccccaccaagaagtcccaggtgttcaccacctaccaggatcagcagacaaccgtctccatccaggtaacagacataagcaaactttcttctttgagtcctgacattacatcctggtcagaaaatttcagctcagaccacctaacgcctctgaatctcgccttgtggtgtaggtctttgagggtgagcgcagcatgaccaaggactgccgtcttctcggcaagttcgacctatctggcattccagcagcaccaaggtttgctcatgtccagaaaaaaatgttagcttactcaaatggataaatgaatccagcgcctgatatctgttggttaaacttgcaggggcaccccccagattgaggtgaccttcgaggtggacgccaacggcatcctgaacgtgaaggctgaggacaagggcaccggcaagtcggagaagatcacgatcacgaacgagaaggggcgcctgagccaggaggagatcgaccggatggtgcgcgaggcggaggagtttgcggaggaggacaagaaggtgaaggagcggatcgacgcccgcaaccagctcgagacctacgtgtacaacatgaagaacaccgtcggcgacaaggacaagctggcggacaagctggagagcgaggagaaggagaaggtggaggaggccctcaaggaggccctcgagtggctggacgagaaccagaccgccgagaaggaggagtacgaggagaagctcaaggaggtcgaggccgtctgcaaccccatcatctccgccgtctaccagaggaccggtggcgccccgggtggcggcgccgacggcgagggcggcgtcgacgacgagcatgacgagctgtagatgatgatgatgatgatctgattcgattgattcaaaggagacagccaatttttgtaagagatggccggttacttttagtggggtgacttactactaccttgggttggggtttaggggtagcaagaggggagagttttatttgcagaacaccagaaaagagactaaatctctcctcttgttacttgtgttgctctcttagtttgttactctgtcgagtgtagaacagctcttccttttgctacttccttctgatttccatgtgaactgtgaagaagaagaagaaacataagtaaattttaattact</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0115900, RefSeq:Os02g0115900