Difference between revisions of "Os12g0476200"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 6: Line 6:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
  The xa25, localized in the centromeric region of chromosome 12[[File:Figure 1.jpg]], mediates race-specific resistance to Xoo strain PXO339 at both seedling and adult stages by inhibiting Xoo growth. It encodes a protein of the MtN3/saliva family, which is prevalent in eukaryotes, including mammals.
+
  The xa25, localized in the centromeric region of chromosome 12[[File:Figure_1.jpg]], mediates race-specific resistance to Xoo strain PXO339 at both seedling and adult stages by inhibiting Xoo growth. It encodes a protein of the MtN3/saliva family, which is prevalent in eukaryotes, including mammals.
  
 
===Expression===
 
===Expression===

Revision as of 14:22, 28 May 2014

Please input one-sentence summary here.


Os01g0136400 is a new dominant gene, for bacterial blight resistance in rice, Xa25(t), which conferred resistance to Philippine race 9 (PXO339) of X.

Annotated Information

Function

The xa25, localized in the centromeric region of chromosome 12Figure 1.jpg, mediates race-specific resistance to Xoo strain PXO339 at both seedling and adult stages by inhibiting Xoo growth. It encodes a protein of the MtN3/saliva family, which is prevalent in eukaryotes, including mammals.

Expression

Transformation of the dominant Xa25 into a resistant rice line carrying the recessive xa25 abolished its resistance to PXO339. The encoding proteins of recessive xa25 and its dominant allele Xa25 have eight amino acid differences. The expression of dominant Xa25 but not recessive xa25 was rapidly induced by PXO339 but not other Xoo strain infections. The nature of xa25-encoding protein and its expression pattern in comparison with its susceptible allele in rice–Xoo interaction indicate that the mechanism of xa25-mediated resistance appears to be different from that conferred by most of the characterized R proteins.

Evolution

Char- acterization of more R genes against Xoo will facilitate evaluation of this inference. In a previous study, we identi- fied and mapped a new R gene against Xoo in rice. This gene localized in rice chromosome 12 and was tentatively named as Xa25(t) (Chen, Wang & Zhang 2002).



You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os12g0476200

Description

MtN3 and saliva related transmembrane protein family protein

Version

NM_001073287.2 GI:297613156 GeneID:4352201

Length

3215 bp

Definition

Oryza sativa Japonica Group Os12g0476200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 12

Location

Chromosome 12:17446841..17450055

Sequence Coding Region

17448475..17448712,17448827..17448863,17449812..17449863

Expression

GEO Profiles:Os12g0476200

Genome Context

<gbrowseImage1> name=NC_008405:17446841..17450055 source=RiceChromosome12 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008405:17446841..17450055 source=RiceChromosome12 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctggcctgtccctgcagcatccctgggcttttgccttcggcctccttggcaacctcatatccttcacgacctatctggcaccaatcccgacgttctaccggatctacaagagcaagtcgacggaggggttccagtcggtgccgtacgtggtggcgctcttcagcgccatgctgtggatcttctacgcgctgatcaagtccaacgaggccctcctcatcaccatcaacgccgccggttgcgtcatcgagaccatctacatcgtcatgtacctcgcctacgcccccaagaaggccaaggttcgatccatgtcatccaaaccctag</cdnaseq>

Protein Sequence

<aaseq>MAGLSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEG FQSVPYVVALFSAMLWIFYALIKSNEALLITINAAGCVIETIYIVMYLAYAPKKAKVR SMSSKP</aaseq>

Gene Sequence

<dnaseqindica>1344..1581#1193..1229#193..244#aagagttttcagccaacacattgaactcttcttcagagctctcccttccctccacaaagggggtctagggttagagtgtgtgtgtctgtgacaagttccaagctagcaacaacaagctcaattccttgcttgtttgcttccatattacactacatctcttcccttcaattaccccccttttagcacacaaaaatggctggcctgtccctgcagcatccctgggcttttgccttcggcctccttggtatatcatcatcacctaccacaactaagacattcccttcattgccaacattttacttctttttattagaaaccattgagtttgtacatataagctcagagttattacttgctggcagatacgcatagctagcgacgacatttagtgaggattacactttagtggtcatcatatataaaataataaaattgttgtgtttctttatttgttttttattttctagctagcttctttcagttattttcaacaaaaagaatttcttctagcacttttatttacagcagtttattatgtctatttgggcatattaattagctactagcgcataagctaaaaaccctactagccttccgaaggcaatatggatggtactcttgtagtaataagccaaaagctagatttgattttttttatttcttttggcttttgtctattagaattatacgcgcggcgccacccttaaaattgcaggcttaaaatccacaagcatataaactacaagggcctaagcatacttaatgagatgcacatagccatataatttttctgcttcttgttaaactatatatatacagcaagtcctcatcatttgtatgtatatcctacttgtggagcaaacattcgatcctttggtgcaacctctatatatttatgttgccatggagagagagtggaattaataggtcaagctatatagtactctaattaatgacatcatagtgcaccatgtaacacaataatttaaagaacaagttaaaagccaaggcacaatctttgttgcaaaggaaggcaagggctagacataaagtttgtaaacgtgtctatctatcacaacttatcacgtctggtcgctaccttagctgcctccatggggctctttactcgcattactttgccttttttcctttacaaaatcctgatcttgtttctgttcctttggctttgcaggcaacctcatatccttcacgacctatctggcaccaatgtaagtaactgaatttctacatgatatatacatatatagcttttgtgtaattttaattcccaatccgcaccgcgttccgtatccgataatatatgtgcataatattttatgcagcccgacgttctaccggatctacaagagcaagtcgacggaggggttccagtcggtgccgtacgtggtggcgctcttcagcgccatgctgtggatcttctacgcgctgatcaagtccaacgaggccctcctcatcaccatcaacgccgccggttgcgtcatcgagaccatctacatcgtcatgtacctcgcctacgcccccaagaaggccaaggttcgatccatgtcatccaaaccctagcactaccacagaaaccctatttcgatgccggtggggacttgggaaccaccctttgattctcgagtcgcaaccggcaccgatgagaggccccttacaggtgtcatcggttgtgaacaagaaccggcacctatataagattgttccatatttaccgttttgtagtagtaaaatataataattgacaagtatatatggttcgacgtcgtttttgcaggtgttcacgacgaagatcctgctgctgctgaacgtgggggtgttcggggtgatcctgctgctgacgctgctgctctcccatggcgagcagcgcgtcgtctccctcggctgggtctgcgtcgccttctccgtcagcgtctttgtcgcgccgctcagcatcatcgtatgtgcatatatacgatcagtcgtcgtcaatctctagctagctcatctttacttcgtgtcttggtttgatcgatcgatctcgttgctaactgaactgcttccatggacgatggatgcgatattgcagaagcgagtgatccagtcgaggagcgtggagtacatgcccttctccctctccctcacgctcaccctcagcgccgtcgtctggttcctctacggccttctcatcaaggacaaatacgtcgcggtaattattcaatcaattacctaattatttcttcaaatcacaaactgctcaattcaaatttatgtgtgtgaccacatgaattgtaattaagctaaaattgtgtgaatttttgcagcttcccaacatcctgggcttcacattcggtgtggtccagatggggctctacgtgttctacatgaacgcgacgccggtggccggcgaggggaaagaagggaaggggaagctggcggcggcggaggagctccccgtcgtcgtcaacgtcggcaagctcgccgccgccacgcccgacaggagcaccggcgccgtgcacgtgcacccagtcccgaggagctgcgcggcggaggcggcggcggccgagccggaggtgctcgtcgacattccgccgccgccgccgccgcgcgccgtcgaggtggccgccgtgtagggtccccggccggtcaacgcgtgcttgcatgggccatgcacgtgtgcagtaccacgtgccacgtacactttaatatgaactccagggcaaacttggaggagacaagctaccaccaattaattaacttaattattattactcatctttcccaaaatataattacttttagcctctaaaatttatctcaaaatatagcaacttcttcacctatattctcttataaaacaatcgtaaccttccattaattaaatttcttacatatatatttctcctcttatcaatcaatcccaactgcctttttttttcattttattcctgtaactttcgtaatatatccgtatatcctatctaaaacttattatattttgggatggtgatggtattatatatctttcttgcatgccatgcaactagagacgggggaagctatgtgtaatgtatgtgcatgtgtttctctggtgttggtttccgcttctgttgtattcatttgtatcggtcaatgggtatctattattcctaattagttccttgtacttgtaatgtatgtcaaaattaataaaaatgtaatcgataaatatctcttct</dnaseqindica>

External Link(s)

NCBI Gene:Os12g0476200, RefSeq:Os12g0476200