Difference between revisions of "Os01g0746400"
(→References) |
(→Expression) |
||
| Line 11: | Line 11: | ||
D10 is a carotenoid cleavage dioxygenase, mainly expressed in vascular cells of various organs, and induced by exogenous auxin.D10 expression predominantly occurs in vascular cells in most organs. Real-time polymerase chain reaction analysis revealed that accumulation of D10 mRNA is induced by exogenous auxin. | D10 is a carotenoid cleavage dioxygenase, mainly expressed in vascular cells of various organs, and induced by exogenous auxin.D10 expression predominantly occurs in vascular cells in most organs. Real-time polymerase chain reaction analysis revealed that accumulation of D10 mRNA is induced by exogenous auxin. | ||
In addition, the expression of D10 up-regulated in 6 mutated branches,including d3,d10,d14,d17,d27,htdi.But MAX2 and MAX3 rice homologous gene D3 and HTD1 have no expression change in these mutants. | In addition, the expression of D10 up-regulated in 6 mutated branches,including d3,d10,d14,d17,d27,htdi.But MAX2 and MAX3 rice homologous gene D3 and HTD1 have no expression change in these mutants. | ||
| − | These finding may indicate that D10's transcription may be key factor of regulating branches inhibition pathway. | + | These finding may indicate that D10's transcription may be key factor of regulating branches inhibition pathway. <ref name="ref3" /> |
| − | Tissue specificity of the expression of D10 and other rice branching genes was examined by reverse transcription polymerase chain reaction (RT-PCR) analysis (Figure 1a). Low levels of D10mRNA were detected in all tissues examined, except for the root tip. Expression in lateral buds and shoot apices was slightly higher than in panicles, leaves and roots. In contrast,D10likewas expressed predominantly in the panicle. As previously reported, D3andHTD1were expressed in all tissues | + | Tissue specificity of the expression of D10 and other rice branching genes was examined by reverse transcription polymerase chain reaction (RT-PCR) analysis (Figure 1a). Low levels of D10mRNA were detected in all tissues examined, except for the root tip. Expression in lateral buds and shoot apices was slightly higher than in panicles, leaves and roots. In contrast,D10likewas expressed predominantly in the panicle. As previously reported, D3andHTD1were expressed in all tissues <ref name="ref5" />. |
Tissue-specific distribution of D10 mRNA was further examined using the D10 promoter GUS(D10:GUS) chimeric gene (Figure 1b–h). Despite differences in the overall intensity of GUS activity, all nine transgenic lines showed a common pattern of GUS distribution. As shown in Figure 1b, GUS staining was detected in vascular cells in roots, nodes, internodes and the inflorescence. GUS expression was hardly observed in leaves . A relatively high level of GUS expression was observed in roots (Figure 1c,d). Consistent with the results obtained from RTPCR analysis, root tips did not show GUS activity. Analysis with a longitudinal section of the root indicated that the GUS activity was localized in the parenchyma cells in the root stele (Figure 1e,f). In the stem, GUS activity was localized in xylem parenchyma cells (Figure 1g,h). | Tissue-specific distribution of D10 mRNA was further examined using the D10 promoter GUS(D10:GUS) chimeric gene (Figure 1b–h). Despite differences in the overall intensity of GUS activity, all nine transgenic lines showed a common pattern of GUS distribution. As shown in Figure 1b, GUS staining was detected in vascular cells in roots, nodes, internodes and the inflorescence. GUS expression was hardly observed in leaves . A relatively high level of GUS expression was observed in roots (Figure 1c,d). Consistent with the results obtained from RTPCR analysis, root tips did not show GUS activity. Analysis with a longitudinal section of the root indicated that the GUS activity was localized in the parenchyma cells in the root stele (Figure 1e,f). In the stem, GUS activity was localized in xylem parenchyma cells (Figure 1g,h). | ||
As shown in Figure 2, levels of D10transcripts were substantially increased in all five dmutants, whereas no such effect was observed infc1. Interestingly,D10like,D3andHTD1expression was unaltered indandfc1mutants, indicating that the level ofD10mRNA accumulation might be a critical step in the regulation of the synthesis of the branching inhibitor. | As shown in Figure 2, levels of D10transcripts were substantially increased in all five dmutants, whereas no such effect was observed infc1. Interestingly,D10like,D3andHTD1expression was unaltered indandfc1mutants, indicating that the level ofD10mRNA accumulation might be a critical step in the regulation of the synthesis of the branching inhibitor. | ||
Revision as of 18:36, 28 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
D10,carotenoid cleavage dioxygenase 8(OsCCD8)controls lateral bud outgrowth of rice, and then ultimate control of rice tillers. OsCCD8 is an important enzyme of biosynthesis Strigolactones process.It´s involved in the biosynthesis of Strigolactones / Strigolactones derivative SL.And D10 may play an important role in auxin regulation of SL.D10 may plays an important role in regulate Strigolactones and its derivatives by auxin , but may reduce the transport ability of auxin and promote the synthesis of cytokinin by reducing the auxin levels at the same time.
Expression
D10 is a carotenoid cleavage dioxygenase, mainly expressed in vascular cells of various organs, and induced by exogenous auxin.D10 expression predominantly occurs in vascular cells in most organs. Real-time polymerase chain reaction analysis revealed that accumulation of D10 mRNA is induced by exogenous auxin. In addition, the expression of D10 up-regulated in 6 mutated branches,including d3,d10,d14,d17,d27,htdi.But MAX2 and MAX3 rice homologous gene D3 and HTD1 have no expression change in these mutants. These finding may indicate that D10's transcription may be key factor of regulating branches inhibition pathway. [1]
Tissue specificity of the expression of D10 and other rice branching genes was examined by reverse transcription polymerase chain reaction (RT-PCR) analysis (Figure 1a). Low levels of D10mRNA were detected in all tissues examined, except for the root tip. Expression in lateral buds and shoot apices was slightly higher than in panicles, leaves and roots. In contrast,D10likewas expressed predominantly in the panicle. As previously reported, D3andHTD1were expressed in all tissues [2]. Tissue-specific distribution of D10 mRNA was further examined using the D10 promoter GUS(D10:GUS) chimeric gene (Figure 1b–h). Despite differences in the overall intensity of GUS activity, all nine transgenic lines showed a common pattern of GUS distribution. As shown in Figure 1b, GUS staining was detected in vascular cells in roots, nodes, internodes and the inflorescence. GUS expression was hardly observed in leaves . A relatively high level of GUS expression was observed in roots (Figure 1c,d). Consistent with the results obtained from RTPCR analysis, root tips did not show GUS activity. Analysis with a longitudinal section of the root indicated that the GUS activity was localized in the parenchyma cells in the root stele (Figure 1e,f). In the stem, GUS activity was localized in xylem parenchyma cells (Figure 1g,h). As shown in Figure 2, levels of D10transcripts were substantially increased in all five dmutants, whereas no such effect was observed infc1. Interestingly,D10like,D3andHTD1expression was unaltered indandfc1mutants, indicating that the level ofD10mRNA accumulation might be a critical step in the regulation of the synthesis of the branching inhibitor.
Evolution
D10 orthologs have been isolated from four species: rice, pea, Arabidopsis and petunia. Feedback upregulation has been observed in three of them: pea RMS1 (Foo et al., 2005), petunia DAD1(Snowden et al., 2005) and rice D10. Although details of molecular mechanisms underlying the feedback control of D10, RMS1 and DAD1 remain to be unraveled, and although the extent of the upregulation varies widely between the three genes, the conservation of the feedback effect indicates that the adjustment of the branching inhibitor level by D10 plays a significant role in the control of shoot branching.
D10 is a rice ortholog of MAX4/RMS1/DAD1 that encodes a carotenoid cleavage dioxygenase 8 and is supposed to be involved in the synthesis of an unidentified inhibitor of shoot branching.encoding a member of the 9-cis epoxycarotenoid dioxygenase family (Tan et al., 2003),is responsible for the synthesis of a novel carotenoid-derived signal molecule that controls shoot branching in rice.
Labs working on this gene
Please input related labs here.
1 The State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese
Academy of Sciences
2 College of Biological Sciences and Biotechnology, Beijing Forestry University
3 Department of Applied Biological Chemistry, The University of Tokyo, 1-1-1 Yayoi, Bunkyo, Tokyo
4 RIKEN Plant Science Center, Japan
5 Research Institute for Bioresources, Okayama University, Kurashiki, Okayama 710-0046, Japan
References
Structured Information
| Gene Name |
Os01g0746400 |
|---|---|
| Description |
Carotenoid oxygenase family protein |
| Version |
NM_001050764.2 GI:297597605 GeneID:4326177 |
| Length |
3109 bp |
| Definition |
Oryza sativa Japonica Group Os01g0746400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:32981304..32984412 |
| Sequence Coding Region |
32981304..32981461,32981562..32981854,32981954..32982147,32982254..32982997,32984092..32984412 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:32981304..32984412 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:32981304..32984412 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtctcccgctatgctgcaggcgtcgtcgctgtgcgtatccgcggcgctgtcaggcgccgcgagccggccgggccgcctggccagccaggggcaccagggcaagcgggccgtggcgcagcctctcgcggctagcgccgtgacggaggcagcgccgcccgcgccggtcgtcgcgccgccggcccgccccgtcgacgccccgcggcgccgtggcggacgtggcggcggcggaggcggcggcgagctcgtggcgtggaagagtgtacggcaggagaggtgggagggtgcgctcgaggtggacggagagctgcctctctggctggatggcacgtacctgaggaacggcccgggactatggaacctcggcgactacggcttccggcacctgttcgacggctacgcgacgctggtgcgcgtctcgttccgcggcggccgcgccgtgggcgcgcaccggcagatcgagtcggaggcgtacaaggcggcgcgcgcgcacggcaaggtgtgctaccgcgagttctcggaggtgcccaagccggacaacttcctgtcctacgtcggccagctggcgaccctcttctcgggctcgtcgctcaccgacaactccaacaccggcgtcgtcatgctcggcgacggccgcgtgctctgcctcacggagaccatcaagggctccatccaggtcgacccggacacgctcgacacggtcggcaagttccagtacacggacaagctgggcgggctgatccactcggcgcacccgatcgtgaccgacaccgagttctggacgctgatccccgacctgatccggcccggctacgtggtggcgaggatggacgccggtagcaacgagaggcagttcgtcggcagggtggactgccgcggcgggccggcgccagggtgggtgcactcgttccccgtcaccgagcactacgtcgtcgtgccggagatgccgctccgctactgcgccaagaacctcctccgcgccgagcccacgccgctgtacaagttcgagtggcacctcgagtccggcagctacatgcacgtcatgtgcaaggccagcggcaagattgtggcgagcgtggaggtgccgccgttcgtgacgttccacttcatcaacgcgtacgaggagacggacgaggaggggcgcgtgacggcgatcatcgccgactgctgcgagcacaacgccaacaccgccatcctcgacaagctccgcctccacaacctccgctcctccagcggccaggacgtcctccccgacgccagggtggggcggttcaggatccccctggacgggagccagttcggcgagctggagacggcgctggacccggaggagcacgggcggggcatggacatgtgcagcatcaacccggcgcacgtcggcagggagtaccggtacgcctacgcctgcggcgcccgccggccgtgcaacttccccaacacgctcaccaaggtcgacctggtggagaggacggccaagaactggcacgaggagggctccgtgccgtccgagcccttcttcgtgccacgccccggcgccaccgaggaagacgacggcgtggcgatatcgatggtgagcgccaaggacgggtcgggctatgcgctggtgctggacggcaagacgttcgaggaggtcgcgcgggccaagttcccgtacgggctgccctacggcttgcactgctgctgggtgcccaggaaaaggaacagcaagtaa</cdnaseq> |
| Protein Sequence |
<aaseq>MSPAMLQASSLCVSAALSGAASRPGRLASQGHQGKRAVAQPLAA SAVTEAAPPAPVVAPPARPVDAPRRRGGRGGGGGGGELVAWKSVRQERWEGALEVDGE LPLWLDGTYLRNGPGLWNLGDYGFRHLFDGYATLVRVSFRGGRAVGAHRQIESEAYKA ARAHGKVCYREFSEVPKPDNFLSYVGQLATLFSGSSLTDNSNTGVVMLGDGRVLCLTE TIKGSIQVDPDTLDTVGKFQYTDKLGGLIHSAHPIVTDTEFWTLIPDLIRPGYVVARM DAGSNERQFVGRVDCRGGPAPGWVHSFPVTEHYVVVPEMPLRYCAKNLLRAEPTPLYK FEWHLESGSYMHVMCKASGKIVASVEVPPFVTFHFINAYEETDEEGRVTAIIADCCEH NANTAILDKLRLHNLRSSSGQDVLPDARVGRFRIPLDGSQFGELETALDPEEHGRGMD MCSINPAHVGREYRYAYACGARRPCNFPNTLTKVDLVERTAKNWHEEGSVPSEPFFVP RPGATEEDDGVAISMVSAKDGSGYALVLDGKTFEEVARAKFPYGLPYGLHCCWVPRKR NSK</aaseq> |
| Gene Sequence |
<dnaseqindica>2952..3109#2559..2851#2266..2459#1416..2159#1..321#atgtctcccgctatgctgcaggcgtcgtcgctgtgcgtatccgcggcgctgtcaggcgccgcgagccggccgggccgcctggccagccaggggcaccagggcaagcgggccgtggcgcagcctctcgcggctagcgccgtgacggaggcagcgccgcccgcgccggtcgtcgcgccgccggcccgccccgtcgacgccccgcggcgccgtggcggacgtggcggcggcggaggcggcggcgagctcgtggcgtggaagagtgtacggcaggagaggtgggagggtgcgctcgaggtggacggagagctgcctctctggctggtgggttaagcctcctactgattgcaaatctccctaaatatgacttgatttggcttttgccttctctccaccctaattaagtattcatgaacacaccataacctcagcattttataagatctgccggtggtcaagctaaggctagccgtgcatttttcattcaagaatgcgaatcttttctgttattttgattcaaaggtttcccagtactccatatcgctttcttgagatcatctataaactaaagatccttttgaacatcttagtaaaaaagcatgcacaacatcttcccacacattgagaaatacgaaaggcactttctggaccacatcactgtgcaacaaatcctttataattaacctaaccattttcatcttgtagcatctccttgattagtgcaggctaaccgctgacctagagcacatatatgcatatagccccagaagggtcctaaaaaggtaccagctttggccacgtacctagcatatttttaccagcagtatctaacacgccagggtatattacttgccgactgtcatttttaatttccactgtgccagcagttgctgaagcactcacccaaatcttcagtaatttgatcgacaaagaggagggcgacactaacttaccctatgctggcctagcgaaaaggagatggcatcttggcactcacgatgcttgcggggaacacaacatatatacccagattctctgctcacccctagcttcgatcggcgacaacaatggcatcactgtcttgtggttgcagttttgttgcaccccgcaactctctgaaaacaaaagtcaaaaaccttggtctcccctaactccaagtgatcttatcactgttcttgccaattttgatagtgacttgatttgaggaattaatacaggtgtacatgtagtataatattgttgtaactttgtagttacactcactaagctatggataatacaatcgtttcagctaattaaaaatgcaatcttctgaggtaagctcgtggatagattaatttgtcggtcgttaattagaggtggacggatttgtcgacgtgctgcaaatgattgatcggatcgatgcatacttgctgcaggatggcacgtacctgaggaacggcccgggactatggaacctcggcgactacggcttccggcacctgttcgacggctacgcgacgctggtgcgcgtctcgttccgcggcggccgcgccgtgggcgcgcaccggcagatcgagtcggaggcgtacaaggcggcgcgcgcgcacggcaaggtgtgctaccgcgagttctcggaggtgcccaagccggacaacttcctgtcctacgtcggccagctggcgaccctcttctcgggctcgtcgctcaccgacaactccaacaccggcgtcgtcatgctcggcgacggccgcgtgctctgcctcacggagaccatcaagggctccatccaggtcgacccggacacgctcgacacggtcggcaagttccagtacacggacaagctgggcgggctgatccactcggcgcacccgatcgtgaccgacaccgagttctggacgctgatccccgacctgatccggcccggctacgtggtggcgaggatggacgccggtagcaacgagaggcagttcgtcggcagggtggactgccgcggcgggccggcgccagggtgggtgcactcgttccccgtcaccgagcactacgtcgtcgtgccggagatgccgctccgctactgcgccaagaacctcctccgcgccgagcccacgccgctgtacaagttcgagtggcacctcgagtccggcagctacatgcacgtcatgtgcaaggccagcggcaagattgtaagccatcatcaatcgctgccgcccgtagtgcgttcccgttttgcctatttaattggttgggtgatctaatgatgatatttgtcgggacgatggccaaccgaaggtggcgagcgtggaggtgccgccgttcgtgacgttccacttcatcaacgcgtacgaggagacggacgaggaggggcgcgtgacggcgatcatcgccgactgctgcgagcacaacgccaacaccgccatcctcgacaagctccgcctccacaacctccgctcctccagcggccaggacgtcctccccgacgccaggtacgtacacacacgagccacacgacgacgtcccgccgtcaatttgctacgctacgcatgcacgtatgcacgatggatgacggggaacaccatgtgtagggtggggcggttcaggatccccctggacgggagccagttcggcgagctggagacggcgctggacccggaggagcacgggcggggcatggacatgtgcagcatcaacccggcgcacgtcggcagggagtaccggtacgcctacgcctgcggcgcccgccggccgtgcaacttccccaacacgctcaccaaggtcgacctggtggagaggacggccaagaactggcacgaggagggctccgtgccgtccgagcccttcttcgtgccacgccccggcgccaccgaggaagacgacggttagtgtcaccatctctcctcgttggctgcgtatacgtacgtcttggctttgcctcgtttcgtttgtaataacttgaccaactctgttattgatggcaggcgtggcgatatcgatggtgagcgccaaggacgggtcgggctatgcgctggtgctggacggcaagacgttcgaggaggtcgcgcgggccaagttcccgtacgggctgccctacggcttgcactgctgctgggtgcccaggaaaaggaacagcaagtaa</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 1.2 1.3 Tomotsugu Arite;Hirotaka Iwata;Kenji Ohshima;Masahiko Maekawa;Masatoshi Nakajima;Mikiko Kojima;Hitoshi Sakakibara and Junko Kyozuka DWARF10, an RMS1/MAX4/DAD1 ortholog, controls lateral bud outgrowth in rice.The Plant Journal, 2007, 51(6): 1019-1029
- ↑ 2.0 2.1 Ishikawa, S., Maekawa, M., Arite, T., Ohnishi, K., Takamure, I. and Kyozuka, J.(2005) Suppression of tiller bud activity in tillering dwarf mutants of rice.Plant Cell Physiol.46, 79–86.
- ↑ Shuying Zhang;Gang Li;Jun Fang;Weiqi Chen;Haipai Jiang;Junhuang Zou;Xue Liu;Xianfeng Zhao;Xiaobing Li;Chengcai Chu;Qi Xie;Xiangning Jiang;Lihuang Zhu. The Interactions among DWARF10, Auxin and Cytokinin Underlie Lateral Bud Outgrowth in Rice.Journal of Integrative Plant Biology, 2010, 52(7): 626-638
- ↑ Shinsaku Ito;Nobutaka Kitahata;Mikihisa Umehara;Atsushi Hanada;Atsutaka Kato;Kotomi Ueno;Kiyoshi Mashiguchi;Junko Kyozuka;Koichi Yoneyama;Shinjiro Yamaguchi;Tadao Asami .A New Lead Chemical for Strigolactone Biosynthesis Inhibitors. Plant and Cell Physiology, 2010, 51(7): 1143-1150
- ↑ Arite T1, Iwata H, Ohshima K, Maekawa M, Nakajima M, Kojima M, Sakakibara H, Kyozuka J. DWARF10, an RMS1/MAX4/DAD1 ortholog, controls lateral bud outgrowth in rice.Plant J. 2007 Sep;51(6):1019-29. Epub 2007 Jul 26.