Difference between revisions of "Os12g0597000"

From RiceWiki
Jump to: navigation, search
(Function)
Line 2: Line 2:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Many developmental and environmental signals are transduced through changes in intracellular calcium concentrations, yet only a few calcium-binding proteins have been identified in plants. Calcineurin B-like (CBL) proteins are calcium-binding proteins that are thought to function as plant signal transduction elements. RNA profiling using a rice (Oryza sativa cv Nipponbare) oligonucleotide microarray was used to monitor gene expression in de-embryonated rice grains. A putative rice CBL gene responded to gibberellic acid, but not abscisic acid, treatment. The CBL gene family in rice contains at least 10 genes and these have extensive similarity to the CBLs of Arabidopsis (Arabidopsis thaliana). In yeast (Saccharomyces cerevisiae) two-hybrid assays, rice CBLs interact with the kinase partners of Arabidopsis CBLs. Only one rice CBL gene, OsCBL2, is up-regulated by GA in the aleurone layer.
+
Many developmental and environmental signals are transduced through changes in intracellular calcium concentrations, yet only a few calcium-binding proteins have been identified in plants. Calcineurin B-like (CBL) proteins are calcium-binding proteins that are thought to function as plant signal transduction elements. RNA profiling using a rice (Oryza sativa cv Nipponbare) oligonucleotide microarray was used to monitor gene expression in de-embryonated rice grains. A putative rice CBL gene responded to gibberellic acid, but not abscisic acid, treatment. The CBL gene family in rice contains at least 10 genes and these have extensive similarity to the CBLs of Arabidopsis (Arabidopsis thaliana). In yeast (Saccharomyces cerevisiae) two-hybrid assays, rice CBLs interact with the kinase partners of Arabidopsis CBLs. Only one rice CBL gene, OsCBL2, is up-regulated by GA in the aleurone layer.<ref name="ref1" />
 +
 
  
 
===Expression===
 
===Expression===
Line 16: Line 17:
  
 
===Knowledge Extension===
 
===Knowledge Extension===
 
+
A homolog with 91% sequence identity to OsCBL2 was cloned from barley (Hordeum
 +
vulgare cv Himalaya), and designated HvCBL2. We examined the localization and function of OsCBL2 and HvCBL2 in rice and
 +
barley aleurone because changes in cytosolic calcium have been implicated in the response of the aleurone cell to GA. Green
 +
fluorescent protein translational fusions of OsCBL2 and OsCBL3 were localized to the tonoplast of aleurone cell protein storage
 +
vacuoles and OsCBL4-green fluorescent protein was localized to the plasma membrane. Data from experiments using antisense
 +
expression of OsCBL2 and HvCBL2 are consistent with a role for OsCBL2 in promoting vacuolation of barley aleurone cells
 +
following treatment with GA.<ref name="ref1" />
 
===Highlight===
 
===Highlight===
 
==Labs working on this gene==
 
==Labs working on this gene==
Line 22: Line 29:
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1">A Gibberellin-Regulated Calcineurin B in Rice Localizes to the Tonoplast and Is Implicated in Vacuole Function Yong-sic Hwang, Paul C. Bethke, Yong Hwa Cheong, Hur-Song Chang, Tong Zhu, Russell L. Jones Plant Physiology, 2005, 138(3): 1347-1358</ref>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 02:48, 29 May 2014

Class B enzyme calcineurin subunit (Calcineurin B-like, CBL) proteins are calcium-binding proteins that are thought to function as plant signal transduction elements.

Annotated Information

Function

Many developmental and environmental signals are transduced through changes in intracellular calcium concentrations, yet only a few calcium-binding proteins have been identified in plants. Calcineurin B-like (CBL) proteins are calcium-binding proteins that are thought to function as plant signal transduction elements. RNA profiling using a rice (Oryza sativa cv Nipponbare) oligonucleotide microarray was used to monitor gene expression in de-embryonated rice grains. A putative rice CBL gene responded to gibberellic acid, but not abscisic acid, treatment. The CBL gene family in rice contains at least 10 genes and these have extensive similarity to the CBLs of Arabidopsis (Arabidopsis thaliana). In yeast (Saccharomyces cerevisiae) two-hybrid assays, rice CBLs interact with the kinase partners of Arabidopsis CBLs. Only one rice CBL gene, OsCBL2, is up-regulated by GA in the aleurone layer.[1]


Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Mutation

Knowledge Extension

A homolog with 91% sequence identity to OsCBL2 was cloned from barley (Hordeum vulgare cv Himalaya), and designated HvCBL2. We examined the localization and function of OsCBL2 and HvCBL2 in rice and barley aleurone because changes in cytosolic calcium have been implicated in the response of the aleurone cell to GA. Green fluorescent protein translational fusions of OsCBL2 and OsCBL3 were localized to the tonoplast of aleurone cell protein storage vacuoles and OsCBL4-green fluorescent protein was localized to the plasma membrane. Data from experiments using antisense expression of OsCBL2 and HvCBL2 are consistent with a role for OsCBL2 in promoting vacuolation of barley aleurone cells following treatment with GA.[1]

Highlight

Labs working on this gene

Please input related labs here.

References

<references> [1]

Structured Information

Gene Name

Os12g0597000

Description

Similar to Calcineurin B-like protein 2 (SOS3-like calcium binding protein 1)

Version

NM_001073722.2 GI:297613475 GeneID:4352701

Length

4999 bp

Definition

Oryza sativa Japonica Group Os12g0597000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 12

Location

Chromosome 12:25266920..25271918

Sequence Coding Region

25267406..25267526,25267658..25267740,25267878..25267937,25269012..25269120,25269336..25269388
,25269882..25269962,25270570..25270682,25271403..25271460

Expression

GEO Profiles:Os12g0597000

Genome Context

<gbrowseImage1> name=NC_008405:25266920..25271918 source=RiceChromosome12 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008405:25266920..25271918 source=RiceChromosome12 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtgcagtgtctcgacggggtgaggcagctgctggcggtcgtgttcaagtgctgcgacctcgagctgaagcagccgcgggggctcgaggatccccaggtcctcgcgagggagaccgtcttcagcgtgagcgaggtcgaggcgctgtacgagctcttcaagaagataagcagtgctgtgattgatgacgggctgattaacaaggaggagtttcagttggcgctgttcaagaccagcaagaaggagagcctgttcgccgaccgtgtatttgatttgtttgacacaaaacacaatggaattttaggatttgatgaatttgctcgtgcactctcagtatttcatccaagtgctccacttgatgagaagattgacttttcattccagttatatgatctcaagcaacaaggctatattgagagacaagaggttaagcagatggttgttgctacacttgctgagtctggaatgaatctttctgatgaaattatagagagcataatcgataagacatttgaggaggcagacacaaagcatgatggaagaattgataaagaagagtggcgcaatctggttcttcgtcatccctctttgctgaagaacatgactctccagtacctcaaggacatcaccactacatttccaagctttgtcttccattcccaggtcgatgacacctga</cdnaseq>

Protein Sequence

<aaseq>MVQCLDGVRQLLAVVFKCCDLELKQPRGLEDPQVLARETVFSVS EVEALYELFKKISSAVIDDGLINKEEFQLALFKTSKKESLFADRVFDLFDTKHNGILG FDEFARALSVFHPSAPLDEKIDFSFQLYDLKQQGYIERQEVKQMVVATLAESGMNLSD EIIESIIDKTFEEADTKHDGRIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVF HSQVDDT</aaseq>

Gene Sequence

<dnaseqindica>487..607#739..821#959..1018#2093..2201#2417..2469#2963..3043#3651..3763#4484..4541#agacgcacgcgcacacgcatacgcatcgcagccagttcatcctcgattcctcccccgaatttccttcgcgatctcaccccgcgtgccctagctagctatcgaatcccgtcacctcggcggcggcggcgagatcggagctccgggttaacctcatccaccgcgaggcgtggaacctctctctctctcgctctcaccacctgaggtgcgcgtggccccgctctgtgatccgattcgatcggtcgcgttggagggagggctcctctattctgcgatggcgattgattgattgattgatctggttggggcttggttgcaggatcgaagatcgaaacccctggcaccggctcgggccgcggaatgggcggccgcggtgagtagctaggtctgcggcggcggagttgttgttgttggtggtggtggtggtggaggaggagttggcggcggagggggcgggggcgttggtggtggtggtggtgggagagtatcatggtgcagtgtctcgacggggtgaggcagctgctggcggtcgtgttcaagtgctgcgacctcgagctgaagcagccgcgggggctcgaggatccccaggtcctcgcgagggagaccgtctgtaagtccgccgcattcgccattggttggggcgccgtactcctccttccttttgttgctgagcctgtctcattgggggaatttgactggtgtgtgtggttgggttggattttgtggccttgtgttgtgcagtcagcgtgagcgaggtcgaggcgctgtacgagctcttcaagaagataagcagtgctgtgattgatgacgggctgattaacaaggttggtgtggagtcctctgttcgcgccacgattttgtatcgtagaattgggattgattgattggttgattgatgaaggcatgttattgtgaacctgtatgcaatcactgactgtgtttgtccgttgaccttgtgcaggaggagtttcagttggcgctgttcaagaccagcaagaaggagagcctgttcgccgaccgtgtaagtctgcattgattgcaaacttgttaattattgtatggtgctgcatgccgttgctctgattcggtatatcgcgctcttctcttttggaagttttgaaaagcgacagatttaggcgcgcctagtcaatgaagcatgagcaattgaacactagagactatttgactatactggacaaaattgaatgcttctaattgcatggaaatagtattagttatctaggattatattggtctaagtttcggatatgctatataccgcatatgctttaatttaggatttttcctttcctgtattgtttcctgccaaacatgtctccaaataacatctgaccgttggttagtcatttccctgccatggcttgtcttccgccctatggcctgcaccatttcattatttcccgctctaatttggccttgtccagaattctctaggcttttccgacatcttatctagtaccttttttaatgttaatcctcatgcatgtttgtttgtaaccaaatcattaattactttatacgtgaaatttcttgaactgttatgctatagcatcagtattacattttacatctcgtgtgtacttgattcgtctgtatcagttacaagtttccttaatcacaatgttcatgtttcgcagatggagtgctgtattatgcataattgggactttgcacatgttttaagtgttttggctattatgttattatgctatcattatgagtgtcttttaccttttgcattgcatctagcacacttctgtatttgagttctgatttgtgagctttgatccgtttgttatccaaatttgagtagtacctttcattggccattcgtactataagcgaatgccttatcgtgtaaatatatttttgtagttaaattccattgaaatcaattggtattgttgtatggctaatactgtccatcacaactgttgtcttgttacatttatcagttgaagctacatgtgaccaaattctttgtagaaaaatagctgtatgatagatgtcagtgcagattttgcctttatctccgtgctgcctcatgttcttaatattctccctgctcttacaggtatttgatttgtttgacacaaaacacaatggaattttaggatttgatgaatttgctcgtgcactctcagtatttcatccaagtgctccacttgatgagaagattgactgtgagttcagacgtactgtagctagatattttactcctcatctatgcagttctaaattatgtattgtcacaataatggcttggagcttatttgcaaaagtatttattgtagacttaaagttgatagtctgacttctatgctgtcctccaggttttctcttgtttacttatcttttctcaacaaaaaattctgaagaagctatgcaatttttgcagtttcattccagttatatgatctcaagcaacaaggctatattgagagacaagaggtattgatgccaaattactcattgcacagtgctccttcaagctagcatgttggcttgtctatatggctcacacacttcgattaattcaacattttcttttattgtttctgatacatgaaatcgtggttttattcatgtaactattctgtacttgatggtctatatttgttgttttgttatggcatactgcagaaagaaatgtcattttttcattaatactgtcagatcactgtcgttgaattttacaagattttaaatcacgtagtagcagcaatagcttaatcatgttgcgtttaggtgagttaggttttgattccaatgaattgcactgggctttgttgctgagagatgatgactatatctgccaatctttaaatagctgatatgccattatcaaagctaaatattttaaatagttttgttgtggatgtcattcttttgggtaggatatttccttttacttcatctatagtttataaaattgatttatcaggttaagcagatggttgttgctacacttgctgagtctggaatgaatctttctgatgaaattatagagagcataatcgataaggtatgttacggtttccatttatattttgttgtgtttggttataccctgtattggatggtatttttttagttggtattttgtggtaatcagtaattctcagcctgcttatataggtcagacttttgtatagcctagccttatcatactacatatatactgtatttactttgcaaatgaaaaactgcatcggtatgtttccttattatataagatgttggtaaaaaaaacattgaacttcttggtgaaacatagtaagaaatgtgccaatttgtaacaataagatgacacgtactaaaagaactataaatgtgtaatattatcatagtattttatgtataaatttactcttcattttcatccaaattatatattaatatattatagacaataatgttcgcacaaattattgtggtttaattagatgtgttctggatggcactatttttaaactgatagaagtaatactgattttgtgctattacttttttttaatagatagatatttagatgacatatcctcaataggcttggcataagatatggtcagtttatcttgtttctttttaattgtaacttccaatgctaaactattttttcttatttgtagacatttgaggaggcagacacaaagcatgatggaagaattgataaagaagagtggcgcaatctggttcttcgtcatccctctttgctgaagaacatgactctccagtacctcaagtaagatatgttttttttttgtttatactctgtatatttttaatagcttggctctttttgttcctgtcttttatttacatctgggcacaattctgaattctctcaacttaatgttggacaccttaagttttcatcttgatagttgtaatggcaatgtttactgctgttcttgaacaaaaatggttggattcggattcccattccaaattttatttgccattgcaatgtcttgcaaaggaaagaatgttacggagagagatgcatgcttgaaatgtgtaaatcaagcatcctctaattaaaattgcgcatgcacatagagtcgcatggaggagtgaggagagcatgttgtatcatctcttgattttaaatagtaattgttttatctaatccataatatgtaagaggaaaagaacaagttcatgattttaaatacatgccttgtcaactcactgcgcatatttttatttctaaaaaaacatgtgttgaactactggatgagttggtcgctccatgtttcagattcaagcaatccacttcacagatacaacagcacttcatatattgacaaaaaataacacactgccttttttgttcttaactaaagaagtattttttttcctaaaaaagattaggtgttcataaaaatgttcaagtctataaaaatgttgtagacacttttgtttttctatagcacaagctaatcttgccacatgtgtgcagggacatcaccactacatttccaagctttgtcttccattcccaggtcgatgacacctgaattcttggatttgtttgaactcaaaccatcagaagaatgctcatgccggttcattaagaattttgatattgggttgttggattgggcagagactccagagctctgtaggatgttgcatgttcgatttgagaagttctcaaatctttaaattgatgtaactttgtttctttcgtttggaagtttagtgtggctggagactttcggggagatgttaaatttctgtctgaatccgtagatcctttattctcttcccctcttttctgtttttctggctagcaatcagaatatcttttctgtttttttggctagcaatcagaatatcggatatagttttgtgaatctttcattttgcgtacaaaataggaaccttcaaaaaaattgatcgtgctggaaaatgttctgttggagtttgcaaattgcaatgatcatgaaatgctctccttttttgagagtttgca</dnaseqindica>

External Link(s)

NCBI Gene:Os12g0597000, RefSeq:Os12g0597000

  1. 1.0 1.1 1.2 A Gibberellin-Regulated Calcineurin B in Rice Localizes to the Tonoplast and Is Implicated in Vacuole Function Yong-sic Hwang, Paul C. Bethke, Yong Hwa Cheong, Hur-Song Chang, Tong Zhu, Russell L. Jones Plant Physiology, 2005, 138(3): 1347-1358