Os01g0733200

The rice OsHsfC1b gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.

Annotated Information

Function

OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress.

Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions.In contrast to class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.

Expression

Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2.OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level.

OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation.

Evolution

To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them . As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B.

You can also add sub-section(s) at will.

Labs working on this gene

Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China Graduate School of the Chinese Academy of Sciences, Beijing 100039, China

References

<references>

Structured Information

Gene Name	Os01g0733200
Description	Similar to Heat shock transcription factor 29 (Fragment)
Version	NM_001050695.1 GI:115439760 GeneID:4324158
Length	1210 bp
Definition	Oryza sativa Japonica Group Os01g0733200, complete gene.
Source	Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome	Chromosome 1
Location	Chromosome 1:32338331..32339540
Sequence Coding Region	32338482..32338730,32338840..32339343
Expression	GEO Profiles:Os01g0733200
Genome Context	<gbrowseImage1> name=NC_008394:32338331..32339540 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>
Gene Structure	<gbrowseImage2> name=NC_008394:32338331..32339540 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>
Coding Sequence	<cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>
Protein Sequence	<aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>
Gene Sequence	<dnaseqindica>152..400#510..1013# 1 gcgcgctcac tccctccctt gcccccaccg acgaacggaa caaatcttag cgaggaaaaa 61 gcgagcgctt ttttcttatc ctgttccgcg ggcgcgctgc cacgaccgaa ccgggaggat 121 acttgcgaat tacacgatcg gttgtggcac tatgatgggc ggcgagtgca aggtccacca 181 gctccaggcc gccggcgacg ggggcccagg cgccgtcgcg ccgttcgtgg cgaagacgtt 241 ccacatggtg agcgacccgt cgacgaacgc cgtcgtgcgc tggggaggcg ccggcaacac 301 gttcctcgtg ctcgaccccg ccgccttctc cgacttcctc ctcccctcct acttcaagca 361 ccgcaacttc gccagcttcg tccggcagct caacacctac gtatgtatat gcgcctcctc 421 tgcttctgcc atctgtgcat agctctgtgt gtggcttcgt gtgtcgtcat ggttgtaact 481 ctttccgttg ctgctgtctt ctctctcagg gattccgcaa ggtggatccg gacaggtggg 541 agttcgcgca cgagtcgttc ctgcgggggc aggcgcagct gctgccgcgg atcgtgcgca 601 agaagaagaa gggcggggcg gcgccggggt gcagggagct gtgcgaggaa ggggaggagg 661 tgcggggcac catcgaggcg gtgcagcggc tgcgggagga gcagaggggc atggaggagg 721 agctccaggc catggaccag aggctgcgcg ccgccgagag ccgcccgggc cagatgatgg 781 cgttcctcgc caagctcgcc gacgaaccgg gcgtcgtgct gcgcgccatg ctcgccaaga 841 aggaggagct ggccgcggcc ggcaacaacg ggtccgatcc ctgcaagagg cggcggatcg 901 gggccgacac ggggcgcggc ggcgtggcga ccggcggcga cgcggccgag atggcgcaga 961 gcagaggcac cgtgccgttc ccgttctctg ttcttggcca agtgttctac tagccgcaac 1021 agggccagat aggtgtacac gtacgcagtc ccccgttgta tatataacaa cagtgtaact 1081 tcgcctcggt ttagttgcct actgttaagt tagtgtactt aagcataata ggagagtttg 1141 gctaagtagc tatcgttgga tttgtgtgta tatatcgact atcgaggggc taataacgcc 1201 tattttgttc</dnaseqindica>
External Link(s)	NCBI Gene:Os01g0733200, RefSeq:Os01g0733200