Difference between revisions of "Os01g0286100"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
  
The OsPIL15 gene is a member of the rice Phytochrome‐interacting factors (PIFs) family, in regulating seedling growth.
+
The OsPIL15 gene(Os01g0286100) is a member of the rice Phytochrome‐interacting factors (PIFs) family, in regulating seedling growth.
  
 
==Annotated Information==
 
==Annotated Information==
Basic helix-loop-helix (bHLH) proteins are the second largest class of plant transcription factors[http://onlinelibrary.wiley.com/doi/10.1111/j.1365-313X.2010.04459.x/full]. They comprise two distinct functional regions, a basic region and a helix-loop-helix. The former is required for DNA binding whereas the latter is needed for protein dimerization[http://mcb.asm.org/content/20/2/429.short]. Based on DNA-binding ability, the proteins are divided into two groups, 1) DNA-binding bHLH and 2) non-DNA-binding bHLH (HLH) also known as atypical bHLH[http://www.plantphysiology.org/content/141/4/1167.short].
+
Nakamura et al. (2007) identified six phytochrome-interacting factor-like(PIL) homologs in rice, designated as OsPIL11 through OsPIL16. OsPIL15 contains six introns and encodes a predicted protein of 637 amino acids. Alignment using the amino acid sequence of the bHLH DNA domain revealed that OsPIL15 is highly similar to Arabidopsis PIF3 [1].
 +
OsPIL15 encodes a basic helix‐loop‐helix factor localized in the nucleus.
 
===Function===
 
===Function===
 
Grain size is a major yield component in rice, and partly controlled by the sizes of the lemma and palea. Molecular mechanisms controlling the sizes of these organs largely remain unknown. In this study, we show that an antagonistic pair of basic helix-loop-helix (bHLH) proteins is involved in determining rice grain length by controlling cell length in the lemma/palea. Overexpression of an atypical bHLH, named POSITIVE REGULATOR OF GRAIN LENGTH 1 (PGL1), in lemma/palea increased grain length and weight in transgenic rice. PGL1 is an atypical non-DNA-binding bHLH and assumed to function as an inhibitor of a typical DNA-binding bHLH through heterodimerization. We identified the interaction partner of PGL1 and named it ANTAGONIST OF PGL1 (APG). PGL1 and APG interacted in vivo and localized in the nucleus. As expected, silencing of APG produced the same phenotype as overexpression of PGL1, suggesting antagonistic roles for the two genes. Transcription of two known grain-length-related genes, GS3 and SRS3, was largely unaffected in the PGL1-overexpressing and APG-silenced plants. Observation of the inner epidermal cells of lemma revealed that are caused by increased cell length. PGL1-APG represents a new grain length and weight-controlling pathway in which APG is a negative regulator whose function is inhibited by PGL1.[http://www.plosone.org/article/info%3Adoi%2F10.1371%2Fjournal.pone.0031325#close]
 
Grain size is a major yield component in rice, and partly controlled by the sizes of the lemma and palea. Molecular mechanisms controlling the sizes of these organs largely remain unknown. In this study, we show that an antagonistic pair of basic helix-loop-helix (bHLH) proteins is involved in determining rice grain length by controlling cell length in the lemma/palea. Overexpression of an atypical bHLH, named POSITIVE REGULATOR OF GRAIN LENGTH 1 (PGL1), in lemma/palea increased grain length and weight in transgenic rice. PGL1 is an atypical non-DNA-binding bHLH and assumed to function as an inhibitor of a typical DNA-binding bHLH through heterodimerization. We identified the interaction partner of PGL1 and named it ANTAGONIST OF PGL1 (APG). PGL1 and APG interacted in vivo and localized in the nucleus. As expected, silencing of APG produced the same phenotype as overexpression of PGL1, suggesting antagonistic roles for the two genes. Transcription of two known grain-length-related genes, GS3 and SRS3, was largely unaffected in the PGL1-overexpressing and APG-silenced plants. Observation of the inner epidermal cells of lemma revealed that are caused by increased cell length. PGL1-APG represents a new grain length and weight-controlling pathway in which APG is a negative regulator whose function is inhibited by PGL1.[http://www.plosone.org/article/info%3Adoi%2F10.1371%2Fjournal.pone.0031325#close]

Revision as of 08:23, 29 May 2014

The OsPIL15 gene(Os01g0286100) is a member of the rice Phytochrome‐interacting factors (PIFs) family, in regulating seedling growth.

Annotated Information

Nakamura et al. (2007) identified six phytochrome-interacting factor-like(PIL) homologs in rice, designated as OsPIL11 through OsPIL16. OsPIL15 contains six introns and encodes a predicted protein of 637 amino acids. Alignment using the amino acid sequence of the bHLH DNA domain revealed that OsPIL15 is highly similar to Arabidopsis PIF3 [1]. OsPIL15 encodes a basic helix‐loop‐helix factor localized in the nucleus.

Function

Grain size is a major yield component in rice, and partly controlled by the sizes of the lemma and palea. Molecular mechanisms controlling the sizes of these organs largely remain unknown. In this study, we show that an antagonistic pair of basic helix-loop-helix (bHLH) proteins is involved in determining rice grain length by controlling cell length in the lemma/palea. Overexpression of an atypical bHLH, named POSITIVE REGULATOR OF GRAIN LENGTH 1 (PGL1), in lemma/palea increased grain length and weight in transgenic rice. PGL1 is an atypical non-DNA-binding bHLH and assumed to function as an inhibitor of a typical DNA-binding bHLH through heterodimerization. We identified the interaction partner of PGL1 and named it ANTAGONIST OF PGL1 (APG). PGL1 and APG interacted in vivo and localized in the nucleus. As expected, silencing of APG produced the same phenotype as overexpression of PGL1, suggesting antagonistic roles for the two genes. Transcription of two known grain-length-related genes, GS3 and SRS3, was largely unaffected in the PGL1-overexpressing and APG-silenced plants. Observation of the inner epidermal cells of lemma revealed that are caused by increased cell length. PGL1-APG represents a new grain length and weight-controlling pathway in which APG is a negative regulator whose function is inhibited by PGL1.[1]

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

[2]Heang D, Sassa H. Antagonistic actions of HLH/bHLH proteins are involved in grain length and weight in rice[J]. PloS one, 2012, 7(2): e31325.

Structured Information

Gene Name

Os01g0286100

Description

Basic helix-loop-helix dimerisation region bHLH domain containing protein

Version

NM_001049310.1 GI:115436033 GeneID:4327916

Length

3148 bp

Definition

Oryza sativa Japonica Group Os01g0286100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:10319113..10322260

Sequence Coding Region

10319429..10319542,10319639..10320124,10320218..10320283,10320371..10320436,10320598..10320690
,10320781..10321867,10321976..10321977

Expression

GEO Profiles:Os01g0286100

Genome Context

<gbrowseImage1> name=NC_008394:10319113..10322260 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:10319113..10322260 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtccgacggcaacgacttcgccgagctgctgtgggagaacggccaggcggtggtgcacgggaggaagaagcacccgcagccggccttcccgccgttcggcttcttcggtggcaccggcggtggcggcggcggcagcagtagtagagcccaggagaggcagcccggcggcatcgatgcgttcgccaaggtggggggcggcttcggcgccttgggcatggctccggcggtgcacgacttcgcttctggcttcggcgccaccacgcaggacaacggtgatgatgacaccgttccgtggatccattaccccataattgacgatgaagacgccgccgcccctgctgctctcgcagcagcggactatggctccgacttcttctccgagctccaggcggcggcggctgccgcggcggccgccgcgccgccgaccgatctcgcctctctgccagcctccaatcacaacggcgccaccaataacagaaatgctccggttgccaccaccaccaccagggaaccctccaaggaaagccacggcggcctgtcggttcccaccacccgagccgagccgcagccgcagccacagctcgccgcagccaagctgcctcggtcgagcggcagcggcggcggcgagggcgtgatgaacttctcgctcttctcccgcccggccgtcctggcgagggcgacgctggagagcgcgcagaggacgcagggcaccgacaataaggcgtccaatgtcaccgcgagcaaccgcgtcgagtcgacggtcgtgcagacggcgagcgggccaaggagcgcaccggcgttcgccgatcagagggcggcggcgtggccgccgcagccgaaggagatgccgttcgcgtccacggcagccgctcccatggccccggccgttaacctgcaccacgagatgggccgtgacagggcaggccgaaccatgcctgtccacaaaaccgaggcgaggaaggcacctgaggccacggtcgcgacatcgtcggtgtgctccggcaacggagctgggagtgacgagctgtggcgccagcagaagcggaagtgccaggcccaggcagagtgctcagctagccaagacgatgatcttgacgatgaacctggagtattgagaaaatctggaaccaggagcacgaaacgcagccgcacagctgaggttcacaatttatcagaaaggaggagaagggacaggatcaatgaaaagatgcgcgctctgcaagaactcattcccaactgcaacaagattgataaagcctcgatgctggatgaagctatagagtacctcaaaacccttcagcttcaagtacagatgatgtccatgggaactgggctgtgcattcctccaatgctattaccaacagccatgcagcacttgcaaattccaccgatggctcatttccctcatctcggcatgggattggggtacgggatgggcgtcttcgacatgagcaacactggagcacttcagatgccacccatgcctggtgctcactttccctgcccaatgatcccaggtgcgtcaccacaaggtcttgggatccctggcacaagcaccatgccaatgtttggggttcctgggcaaacaattccttcgtcagcgtctagtgtaccaccatttgcatctttggctggtcttcctgttaggccaagcggggtccctcaagtatcaggcgccatggctaacatggtgcaagaccagcaacaaggcatagcgaatcaacagcagcaatgtctgaacaaggaagctatacagggagcaaatccaggtgattcacaaatgcagatcatcatgcagggtgacaacgagaattttaggataccctcttcagcccaaacaaaaagcagtcaattttcagatggtaccggcaaggggaccaacgctagagagagagatggggctgaaacataa</cdnaseq>

Protein Sequence

<aaseq>MSDGNDFAELLWENGQAVVHGRKKHPQPAFPPFGFFGGTGGGGG GSSSRAQERQPGGIDAFAKVGGGFGALGMAPAVHDFASGFGATTQDNGDDDTVPWIHY PIIDDEDAAAPAALAAADYGSDFFSELQAAAAAAAAAAPPTDLASLPASNHNGATNNR NAPVATTTTREPSKESHGGLSVPTTRAEPQPQPQLAAAKLPRSSGSGGGEGVMNFSLF SRPAVLARATLESAQRTQGTDNKASNVTASNRVESTVVQTASGPRSAPAFADQRAAAW PPQPKEMPFASTAAAPMAPAVNLHHEMGRDRAGRTMPVHKTEARKAPEATVATSSVCS GNGAGSDELWRQQKRKCQAQAECSASQDDDLDDEPGVLRKSGTRSTKRSRTAEVHNLS ERRRRDRINEKMRALQELIPNCNKIDKASMLDEAIEYLKTLQLQVQMMSMGTGLCIPP MLLPTAMQHLQIPPMAHFPHLGMGLGYGMGVFDMSNTGALQMPPMPGAHFPCPMIPGA SPQGLGIPGTSTMPMFGVPGQTIPSSASSVPPFASLAGLPVRPSGVPQVSGAMANMVQ DQQQGIANQQQQCLNKEAIQGANPGDSQMQIIMQGDNENFRIPSSAQTKSSQFSDGTG KGTNARERDGAET</aaseq>

Gene Sequence

<dnaseqindica>2719..2832#2137..2622#1978..2043#1825..1890#1571..1663#394..1480#284..285#aggtccccccacgccacagcctcttatcccacacgcggaccaacagcgccgccccgcccgtcccccgcttcaccttcggcttcgacttcggcttcgtttcctcttctcttcgtctctccctccctccagcgaaagaaagagagagctcacctcgcgttgcccggccggccgcggaggagagcacggcttcgcattcggctggagctctcgtctctgcactcggagtacagctgcaaactcctccttccttgatttcttcaccctgtctccacggactgcacagatgtgggtgcaacgcgatctttcgctgcctccggtttagctctccggttgattccgatcgaggaagctgatgcatgtgtttgtatatggctcggtgttttgtgtgtgcaggtccgacggcaacgacttcgccgagctgctgtgggagaacggccaggcggtggtgcacgggaggaagaagcacccgcagccggccttcccgccgttcggcttcttcggtggcaccggcggtggcggcggcggcagcagtagtagagcccaggagaggcagcccggcggcatcgatgcgttcgccaaggtggggggcggcttcggcgccttgggcatggctccggcggtgcacgacttcgcttctggcttcggcgccaccacgcaggacaacggtgatgatgacaccgttccgtggatccattaccccataattgacgatgaagacgccgccgcccctgctgctctcgcagcagcggactatggctccgacttcttctccgagctccaggcggcggcggctgccgcggcggccgccgcgccgccgaccgatctcgcctctctgccagcctccaatcacaacggcgccaccaataacagaaatgctccggttgccaccaccaccaccagggaaccctccaaggaaagccacggcggcctgtcggttcccaccacccgagccgagccgcagccgcagccacagctcgccgcagccaagctgcctcggtcgagcggcagcggcggcggcgagggcgtgatgaacttctcgctcttctcccgcccggccgtcctggcgagggcgacgctggagagcgcgcagaggacgcagggcaccgacaataaggcgtccaatgtcaccgcgagcaaccgcgtcgagtcgacggtcgtgcagacggcgagcgggccaaggagcgcaccggcgttcgccgatcagagggcggcggcgtggccgccgcagccgaaggagatgccgttcgcgtccacggcagccgctcccatggccccggccgttaacctgcaccacgagatgggccgtgacagggcaggccgaaccatgcctgtccacaaaaccgaggcgaggaaggcacctgaggccacggtcgcgacatcgtcggtgtgctccggcaacggagctgggagtgacgagctgtggcgccagcagaagcggaagtgccaggcccaggcagagtgctcagctagccaagacgatgtaagtaaatggtatgagatagatatgcactgcataaccagctgactataccttcgctgattctcatgataaaaaactggttctattcaggatcttgacgatgaacctggagtattgagaaaatctggaaccaggagcacgaaacgcagccgcacagctgaggttcacaatttatcagaaagggtgagtagctcacatcttcagtgcatggatcatcctgcatccatttgcttcaaagttcacatgtcagtgcattgatcatcctgcatccatttgcttcaatcccatgactcgactcatgctgcaattttattgactgtattgcaacccaacaatctttgcagaggagaagggacaggatcaatgaaaagatgcgcgctctgcaagaactcattcccaactgcaacaaggtaaagataagccattccatcgtcttgctccctctgagatgcctctgaatgaacatttggtcaattcaggcatgctatgttttgcagattgataaagcctcgatgctggatgaagctatagagtacctcaaaacccttcagcttcaagtacaggtacattgaaactgccttcgaacaaatgtaccatgattgtcgggtgaatatgtacatagatgcattgacaaggtgcagttgtcattgacacagatgatgtccatgggaactgggctgtgcattcctccaatgctattaccaacagccatgcagcacttgcaaattccaccgatggctcatttccctcatctcggcatgggattggggtacgggatgggcgtcttcgacatgagcaacactggagcacttcagatgccacccatgcctggtgctcactttccctgcccaatgatcccaggtgcgtcaccacaaggtcttgggatccctggcacaagcaccatgccaatgtttggggttcctgggcaaacaattccttcgtcagcgtctagtgtaccaccatttgcatctttggctggtcttcctgttaggccaagcggggtccctcaagtatcaggcgccatggctaacatggtgcaagaccagcaacaaggcatagcgaatcaacagcagcaatgtctgaacaaggaagctatacagggagcaaatccaggtgattcacaaatgcagatcatcatgcaggtactaattaaaaattaacaaatgatgtcaagcgaatagaagacatttgctagtacttaagtgcattacttactccagtttattttaatattccagggtgacaacgagaattttaggataccctcttcagcccaaacaaaaagcagtcaattttcagatggtaccggcaaggggaccaacgctagagagagagatggggctgaaacataaagaaaggccagtaggtgtaacttgactttcatgctaaatttgagatctaccactgaaatctgcagaatgttcctgtcctaaaaagatcaatggctgaggaatttcatgtacgaccaactaacaacttccagatatgaaagttagcaattcatactgggagaacttacttgagtatcaagatccacgaggcagatgtatcagccaagatgccccaaaattttgtgtaaaatgtagatggtagaagatgctaccaggttacaagctgtaattcttgacttccagtgcagtttcctatgagtagtttttgccctatctg</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0286100, RefSeq:Os01g0286100