Difference between revisions of "Os01g0286100"
| Line 1: | Line 1: | ||
| − | The OsPIL15 gene (Os01g0286100), a phytochromeinteracting factor-like protein gene, is a member of the rice Phytochrome‐interacting factors (PIFs) family, in regulating seedling growth. | + | The ''OsPIL15'' gene (Os01g0286100), a phytochromeinteracting factor-like protein gene, is a member of the rice Phytochrome‐interacting factors (PIFs) family, in regulating seedling growth. |
==Annotated Information== | ==Annotated Information== | ||
| − | Nakamura et al.(2007) identified six phytochrome-interacting factor-like(PIL) homologs in rice, designated as ''OsPIL11'' through ''OsPIL16''. ''OsPIL15'' contains six introns and encodes a predicted protein of 637 amino acids. Alignment using the amino acid sequence of the bHLH DNA domain revealed that OsPIL15 is highly similar to Arabidopsis PIF3 [1]. | + | Nakamura et al.(2007) identified six phytochrome-interacting factor-like(PIL) homologs in rice, designated as ''OsPIL11'' through ''OsPIL16''. ''OsPIL15'' contains six introns and encodes a predicted protein of 637 amino acids. Alignment using the amino acid sequence of the bHLH DNA domain revealed that ''OsPIL15'' is highly similar to Arabidopsis PIF3 [1]. |
| − | OsPIL15 encodes a basic | + | |
| + | ''OsPIL15'' encodes a basic helix-loop-helix factor localized in the nucleus. | ||
| + | |||
===Function=== | ===Function=== | ||
| − | OsPIL15-OX seedlings exhibit an exaggerated shorter aboveground part and undeveloped root system relative to wild-type seedling. OsPIL15 represses a set of genes involved in auxin pathways and cell wall organization or biogenesis. Exposure to red light or | + | OsPIL15-OX seedlings exhibit an exaggerated shorter aboveground part and undeveloped root system relative to wild-type seedling. ''OsPIL15'' represses a set of genes involved in auxin pathways and cell wall organization or biogenesis. Exposure to red light or far-red light relieved growth retardation and promoted seedling elongation in the OsPIL15-OX lines. The results suggest that light regulation of OsPIL15 expression is probably involved in photomorphogenesis in rice[2]. |
| − | In addition, OsPIL13 and OsPIL15 colocalize with OsPRR1, an ortholog of the Arabidopsis APRR1 gene that controls photoperiodic flowering response through clock function. Overexpression of OsLF might repress expression of OsGI and Hd1 by competing with OsPRR1 in interacting with OsPIL13 and OsPIL15 and thus induce late flowering[3]. | + | In addition, ''OsPIL13'' and ''OsPIL15'' colocalize with ''OsPRR1'', an ortholog of the Arabidopsis ''APRR1'' gene that controls photoperiodic flowering response through clock function. Overexpression of ''OsLF'' might repress expression of ''OsGI'' and ''Hd1'' by competing with ''OsPRR1'' in interacting with ''OsPIL13'' and ''OsPIL15'', and thus induce late flowering[3]. |
===Expression=== | ===Expression=== | ||
| − | OsPIF15 gene is widely expressed in leaves, roots, stems, young spike, spike, old embryos and other tissues. The expression level in the leaves is significantly higher than other tissues, especially in the flag leaf. The xpression of OsPIF15 gene is regulated by development and is closely related to phyB. | + | ''OsPIF15'' gene is widely expressed in leaves, roots, stems, young spike, spike, old embryos and other tissues. The expression level in the leaves is significantly higher than other tissues, especially in the flag leaf. The xpression of OsPIF15 gene is regulated by development and is closely related to ''phyB''. |
===Evolution=== | ===Evolution=== | ||
| − | The OsPIL15-OX lines: To construct the OsPIL15-overexpression vector, the ORF region of OsPIL15 was amplified by PCR from its full length cDNA clone J033088H. The primer pair used for the amplification and introduction of the restriction sites was 5’‐AAACTAGTATGTCCGACGGCAACGAC‐3’ (SpeI site underlined) and 5’ | + | The OsPIL15-OX lines: To construct the OsPIL15-overexpression vector, the ORF region of ''OsPIL15'' was amplified by PCR from its full length cDNA clone J033088H. The primer pair used for the amplification and introduction of the restriction sites was 5’‐AAACTAGTATGTCCGACGGCAACGAC‐3’ (SpeI site underlined) and 5’ |
‐ATGGTCACCTTATGTTTCAGCCCCATCTC‐3’ (BstEII site underlined). The resulting PCR product was digested with SpeI and BstEII and subcloned into the p1390‐Ubi vector between the maize ubiquitin promoter and the nos terminator. The plasmid was introduced into Agrobacterium | ‐ATGGTCACCTTATGTTTCAGCCCCATCTC‐3’ (BstEII site underlined). The resulting PCR product was digested with SpeI and BstEII and subcloned into the p1390‐Ubi vector between the maize ubiquitin promoter and the nos terminator. The plasmid was introduced into Agrobacterium | ||
tumefaciens strain EHA105[4] by electroporation[2]. | tumefaciens strain EHA105[4] by electroporation[2]. | ||
| Line 28: | Line 30: | ||
[1] Nakamura Y, Kato Y, Yamashino Y, Murakami M, Mizuno T. Characterization of a set of phytochrome‐interacting‐factor‐like bHLH proteins in Oryza sativa. Biosci Biotech Biochem, 2007(71): 1183-1191. | [1] Nakamura Y, Kato Y, Yamashino Y, Murakami M, Mizuno T. Characterization of a set of phytochrome‐interacting‐factor‐like bHLH proteins in Oryza sativa. Biosci Biotech Biochem, 2007(71): 1183-1191. | ||
| − | [2] Zhou J, Liu Q, Zhang F, Wang Y, Zhang S, Cheng H, Yan L, Li L,Chen F, Xie X. Overexpression of OsPIL15, a phytochromeinteracting factor‐like protein gene, represses etiolated seedling growth in rice. Journal Of Integrative Plant Biology, 56: 373-387. | + | [2] Zhou J, Liu Q, Zhang F, Wang Y, Zhang S, Cheng H, Yan L, Li L,Chen F, Xie X. Overexpression of ''OsPIL15'', a phytochromeinteracting factor‐like protein gene, represses etiolated seedling growth in rice. Journal Of Integrative Plant Biology, 56: 373-387. |
| − | [3] Zhao XL, Shi ZY, Peng LT. An atypical HLH protein OsLF in rice regulates flowering time and interacts with OsPIL13 and OsPIL15. New Biotechnology, 2011(28): 788-797. | + | [3] Zhao XL, Shi ZY, Peng LT. An atypical HLH protein OsLF in rice regulates flowering time and interacts with ''OsPIL13'' and ''OsPIL15''. New Biotechnology, 2011(28): 788-797. |
[4] Hood E, Gelvin S, Melchers L, Hoekema A. New Agrobacterium helper plasmids for gene transfer to plants. Transgenic Res, 1993, 2:208-218. | [4] Hood E, Gelvin S, Melchers L, Hoekema A. New Agrobacterium helper plasmids for gene transfer to plants. Transgenic Res, 1993, 2:208-218. | ||
Revision as of 09:33, 29 May 2014
The OsPIL15 gene (Os01g0286100), a phytochromeinteracting factor-like protein gene, is a member of the rice Phytochrome‐interacting factors (PIFs) family, in regulating seedling growth.
Contents
Annotated Information
Nakamura et al.(2007) identified six phytochrome-interacting factor-like(PIL) homologs in rice, designated as OsPIL11 through OsPIL16. OsPIL15 contains six introns and encodes a predicted protein of 637 amino acids. Alignment using the amino acid sequence of the bHLH DNA domain revealed that OsPIL15 is highly similar to Arabidopsis PIF3 [1].
OsPIL15 encodes a basic helix-loop-helix factor localized in the nucleus.
Function
OsPIL15-OX seedlings exhibit an exaggerated shorter aboveground part and undeveloped root system relative to wild-type seedling. OsPIL15 represses a set of genes involved in auxin pathways and cell wall organization or biogenesis. Exposure to red light or far-red light relieved growth retardation and promoted seedling elongation in the OsPIL15-OX lines. The results suggest that light regulation of OsPIL15 expression is probably involved in photomorphogenesis in rice[2].
In addition, OsPIL13 and OsPIL15 colocalize with OsPRR1, an ortholog of the Arabidopsis APRR1 gene that controls photoperiodic flowering response through clock function. Overexpression of OsLF might repress expression of OsGI and Hd1 by competing with OsPRR1 in interacting with OsPIL13 and OsPIL15, and thus induce late flowering[3].
Expression
OsPIF15 gene is widely expressed in leaves, roots, stems, young spike, spike, old embryos and other tissues. The expression level in the leaves is significantly higher than other tissues, especially in the flag leaf. The xpression of OsPIF15 gene is regulated by development and is closely related to phyB.
Evolution
The OsPIL15-OX lines: To construct the OsPIL15-overexpression vector, the ORF region of OsPIL15 was amplified by PCR from its full length cDNA clone J033088H. The primer pair used for the amplification and introduction of the restriction sites was 5’‐AAACTAGTATGTCCGACGGCAACGAC‐3’ (SpeI site underlined) and 5’ ‐ATGGTCACCTTATGTTTCAGCCCCATCTC‐3’ (BstEII site underlined). The resulting PCR product was digested with SpeI and BstEII and subcloned into the p1390‐Ubi vector between the maize ubiquitin promoter and the nos terminator. The plasmid was introduced into Agrobacterium tumefaciens strain EHA105[4] by electroporation[2].
Labs working on this gene
·Shandong Rice Research Institute, Shandong Academy of Agricultural Sciences, Jinan 250100, China
·Laboratory of Molecular Microbiology, School of Agriculture, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan
·National Key Laboratory of Plant Molecular Genetics, Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, China
References
[1] Nakamura Y, Kato Y, Yamashino Y, Murakami M, Mizuno T. Characterization of a set of phytochrome‐interacting‐factor‐like bHLH proteins in Oryza sativa. Biosci Biotech Biochem, 2007(71): 1183-1191.
[2] Zhou J, Liu Q, Zhang F, Wang Y, Zhang S, Cheng H, Yan L, Li L,Chen F, Xie X. Overexpression of OsPIL15, a phytochromeinteracting factor‐like protein gene, represses etiolated seedling growth in rice. Journal Of Integrative Plant Biology, 56: 373-387.
[3] Zhao XL, Shi ZY, Peng LT. An atypical HLH protein OsLF in rice regulates flowering time and interacts with OsPIL13 and OsPIL15. New Biotechnology, 2011(28): 788-797.
[4] Hood E, Gelvin S, Melchers L, Hoekema A. New Agrobacterium helper plasmids for gene transfer to plants. Transgenic Res, 1993, 2:208-218.
Structured Information
| Gene Name |
Os01g0286100 |
|---|---|
| Description |
Basic helix-loop-helix dimerisation region bHLH domain containing protein |
| Version |
NM_001049310.1 GI:115436033 GeneID:4327916 |
| Length |
3148 bp |
| Definition |
Oryza sativa Japonica Group Os01g0286100, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:10319113..10322260 |
| Sequence Coding Region |
10319429..10319542,10319639..10320124,10320218..10320283,10320371..10320436,10320598..10320690 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:10319113..10322260 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:10319113..10322260 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtccgacggcaacgacttcgccgagctgctgtgggagaacggccaggcggtggtgcacgggaggaagaagcacccgcagccggccttcccgccgttcggcttcttcggtggcaccggcggtggcggcggcggcagcagtagtagagcccaggagaggcagcccggcggcatcgatgcgttcgccaaggtggggggcggcttcggcgccttgggcatggctccggcggtgcacgacttcgcttctggcttcggcgccaccacgcaggacaacggtgatgatgacaccgttccgtggatccattaccccataattgacgatgaagacgccgccgcccctgctgctctcgcagcagcggactatggctccgacttcttctccgagctccaggcggcggcggctgccgcggcggccgccgcgccgccgaccgatctcgcctctctgccagcctccaatcacaacggcgccaccaataacagaaatgctccggttgccaccaccaccaccagggaaccctccaaggaaagccacggcggcctgtcggttcccaccacccgagccgagccgcagccgcagccacagctcgccgcagccaagctgcctcggtcgagcggcagcggcggcggcgagggcgtgatgaacttctcgctcttctcccgcccggccgtcctggcgagggcgacgctggagagcgcgcagaggacgcagggcaccgacaataaggcgtccaatgtcaccgcgagcaaccgcgtcgagtcgacggtcgtgcagacggcgagcgggccaaggagcgcaccggcgttcgccgatcagagggcggcggcgtggccgccgcagccgaaggagatgccgttcgcgtccacggcagccgctcccatggccccggccgttaacctgcaccacgagatgggccgtgacagggcaggccgaaccatgcctgtccacaaaaccgaggcgaggaaggcacctgaggccacggtcgcgacatcgtcggtgtgctccggcaacggagctgggagtgacgagctgtggcgccagcagaagcggaagtgccaggcccaggcagagtgctcagctagccaagacgatgatcttgacgatgaacctggagtattgagaaaatctggaaccaggagcacgaaacgcagccgcacagctgaggttcacaatttatcagaaaggaggagaagggacaggatcaatgaaaagatgcgcgctctgcaagaactcattcccaactgcaacaagattgataaagcctcgatgctggatgaagctatagagtacctcaaaacccttcagcttcaagtacagatgatgtccatgggaactgggctgtgcattcctccaatgctattaccaacagccatgcagcacttgcaaattccaccgatggctcatttccctcatctcggcatgggattggggtacgggatgggcgtcttcgacatgagcaacactggagcacttcagatgccacccatgcctggtgctcactttccctgcccaatgatcccaggtgcgtcaccacaaggtcttgggatccctggcacaagcaccatgccaatgtttggggttcctgggcaaacaattccttcgtcagcgtctagtgtaccaccatttgcatctttggctggtcttcctgttaggccaagcggggtccctcaagtatcaggcgccatggctaacatggtgcaagaccagcaacaaggcatagcgaatcaacagcagcaatgtctgaacaaggaagctatacagggagcaaatccaggtgattcacaaatgcagatcatcatgcagggtgacaacgagaattttaggataccctcttcagcccaaacaaaaagcagtcaattttcagatggtaccggcaaggggaccaacgctagagagagagatggggctgaaacataa</cdnaseq> |
| Protein Sequence |
<aaseq>MSDGNDFAELLWENGQAVVHGRKKHPQPAFPPFGFFGGTGGGGG GSSSRAQERQPGGIDAFAKVGGGFGALGMAPAVHDFASGFGATTQDNGDDDTVPWIHY PIIDDEDAAAPAALAAADYGSDFFSELQAAAAAAAAAAPPTDLASLPASNHNGATNNR NAPVATTTTREPSKESHGGLSVPTTRAEPQPQPQLAAAKLPRSSGSGGGEGVMNFSLF SRPAVLARATLESAQRTQGTDNKASNVTASNRVESTVVQTASGPRSAPAFADQRAAAW PPQPKEMPFASTAAAPMAPAVNLHHEMGRDRAGRTMPVHKTEARKAPEATVATSSVCS GNGAGSDELWRQQKRKCQAQAECSASQDDDLDDEPGVLRKSGTRSTKRSRTAEVHNLS ERRRRDRINEKMRALQELIPNCNKIDKASMLDEAIEYLKTLQLQVQMMSMGTGLCIPP MLLPTAMQHLQIPPMAHFPHLGMGLGYGMGVFDMSNTGALQMPPMPGAHFPCPMIPGA SPQGLGIPGTSTMPMFGVPGQTIPSSASSVPPFASLAGLPVRPSGVPQVSGAMANMVQ DQQQGIANQQQQCLNKEAIQGANPGDSQMQIIMQGDNENFRIPSSAQTKSSQFSDGTG KGTNARERDGAET</aaseq> |
| Gene Sequence |
<dnaseqindica>2719..2832#2137..2622#1978..2043#1825..1890#1571..1663#394..1480#284..285#aggtccccccacgccacagcctcttatcccacacgcggaccaacagcgccgccccgcccgtcccccgcttcaccttcggcttcgacttcggcttcgtttcctcttctcttcgtctctccctccctccagcgaaagaaagagagagctcacctcgcgttgcccggccggccgcggaggagagcacggcttcgcattcggctggagctctcgtctctgcactcggagtacagctgcaaactcctccttccttgatttcttcaccctgtctccacggactgcacagatgtgggtgcaacgcgatctttcgctgcctccggtttagctctccggttgattccgatcgaggaagctgatgcatgtgtttgtatatggctcggtgttttgtgtgtgcaggtccgacggcaacgacttcgccgagctgctgtgggagaacggccaggcggtggtgcacgggaggaagaagcacccgcagccggccttcccgccgttcggcttcttcggtggcaccggcggtggcggcggcggcagcagtagtagagcccaggagaggcagcccggcggcatcgatgcgttcgccaaggtggggggcggcttcggcgccttgggcatggctccggcggtgcacgacttcgcttctggcttcggcgccaccacgcaggacaacggtgatgatgacaccgttccgtggatccattaccccataattgacgatgaagacgccgccgcccctgctgctctcgcagcagcggactatggctccgacttcttctccgagctccaggcggcggcggctgccgcggcggccgccgcgccgccgaccgatctcgcctctctgccagcctccaatcacaacggcgccaccaataacagaaatgctccggttgccaccaccaccaccagggaaccctccaaggaaagccacggcggcctgtcggttcccaccacccgagccgagccgcagccgcagccacagctcgccgcagccaagctgcctcggtcgagcggcagcggcggcggcgagggcgtgatgaacttctcgctcttctcccgcccggccgtcctggcgagggcgacgctggagagcgcgcagaggacgcagggcaccgacaataaggcgtccaatgtcaccgcgagcaaccgcgtcgagtcgacggtcgtgcagacggcgagcgggccaaggagcgcaccggcgttcgccgatcagagggcggcggcgtggccgccgcagccgaaggagatgccgttcgcgtccacggcagccgctcccatggccccggccgttaacctgcaccacgagatgggccgtgacagggcaggccgaaccatgcctgtccacaaaaccgaggcgaggaaggcacctgaggccacggtcgcgacatcgtcggtgtgctccggcaacggagctgggagtgacgagctgtggcgccagcagaagcggaagtgccaggcccaggcagagtgctcagctagccaagacgatgtaagtaaatggtatgagatagatatgcactgcataaccagctgactataccttcgctgattctcatgataaaaaactggttctattcaggatcttgacgatgaacctggagtattgagaaaatctggaaccaggagcacgaaacgcagccgcacagctgaggttcacaatttatcagaaagggtgagtagctcacatcttcagtgcatggatcatcctgcatccatttgcttcaaagttcacatgtcagtgcattgatcatcctgcatccatttgcttcaatcccatgactcgactcatgctgcaattttattgactgtattgcaacccaacaatctttgcagaggagaagggacaggatcaatgaaaagatgcgcgctctgcaagaactcattcccaactgcaacaaggtaaagataagccattccatcgtcttgctccctctgagatgcctctgaatgaacatttggtcaattcaggcatgctatgttttgcagattgataaagcctcgatgctggatgaagctatagagtacctcaaaacccttcagcttcaagtacaggtacattgaaactgccttcgaacaaatgtaccatgattgtcgggtgaatatgtacatagatgcattgacaaggtgcagttgtcattgacacagatgatgtccatgggaactgggctgtgcattcctccaatgctattaccaacagccatgcagcacttgcaaattccaccgatggctcatttccctcatctcggcatgggattggggtacgggatgggcgtcttcgacatgagcaacactggagcacttcagatgccacccatgcctggtgctcactttccctgcccaatgatcccaggtgcgtcaccacaaggtcttgggatccctggcacaagcaccatgccaatgtttggggttcctgggcaaacaattccttcgtcagcgtctagtgtaccaccatttgcatctttggctggtcttcctgttaggccaagcggggtccctcaagtatcaggcgccatggctaacatggtgcaagaccagcaacaaggcatagcgaatcaacagcagcaatgtctgaacaaggaagctatacagggagcaaatccaggtgattcacaaatgcagatcatcatgcaggtactaattaaaaattaacaaatgatgtcaagcgaatagaagacatttgctagtacttaagtgcattacttactccagtttattttaatattccagggtgacaacgagaattttaggataccctcttcagcccaaacaaaaagcagtcaattttcagatggtaccggcaaggggaccaacgctagagagagagatggggctgaaacataaagaaaggccagtaggtgtaacttgactttcatgctaaatttgagatctaccactgaaatctgcagaatgttcctgtcctaaaaagatcaatggctgaggaatttcatgtacgaccaactaacaacttccagatatgaaagttagcaattcatactgggagaacttacttgagtatcaagatccacgaggcagatgtatcagccaagatgccccaaaattttgtgtaaaatgtagatggtagaagatgctaccaggttacaagctgtaattcttgacttccagtgcagtttcctatgagtagtttttgccctatctg</dnaseqindica> |
| External Link(s) |