Difference between revisions of "Os05g0519700"

From RiceWiki
Jump to: navigation, search
(Expression)
(Evolution)
Line 31: Line 31:
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
 +
HSP100 proteins belong to ClpB family. Clp
 +
ATPases maintain quality of cellular proteins by performing
 +
the function of molecular chaperones and
 +
energy dependent proteases. Clp (Caseinolytic Protease)
 +
system was first identified as a heat shock inducible,
 +
multicomponent, ATP-dependent protease complex able
 +
to hydrolyze casein. Subsequent studies showed
 +
that the Clp system can hydrolyze numerous other proteins
 +
and peptides in both aggregated and non-aggregated
 +
forms Clp ATPases fall within the AAA+
 +
superfamily of ATPases associated with a substantially
 +
broader range of biological processes. Class I
 +
ATPases (ClpA, ClpB, ClpC, ClpD) have two ATP binding
 +
domains and class II Clp ATPases (ClpM, ClpN,
 +
ClpX, ClpY) have one ATP binding domain. Clp
 +
proteins are localized in various cellular organelles in
 +
plants. Basically, Clp system members include three
 +
non-homologous gene families: ClpABCXY, ClpP and
 +
ClpQ. ClpACX members (but not ClpB) facilitate the
 +
activity of ClpP and some, such as ClpA and ClpX,can function as independent chaperones in roles
 +
analogous to those of DnaK and DnaJ proteins. In contrast,
 +
ClpP proteolytic subunit exhibits low levels of peptidolytic
 +
activity. Further, when ClpP is complexed with
 +
ClpA, ClpC or ClpX, active holoenzymes which are able
 +
to cleave denatured proteins are formed. ClpAP, ClpXP
 +
and HslUV proteases are similar in design to the eukaryotic
 +
26 S proteasome, with the ATPase subunits guarding
 +
the entrance to the proteolytic chamber. Clp proteases in bacterial and eukaryotic systems have been
 +
implicated in vital cellular processes such as sporulation,
 +
DNA replication, protein turnover, stress tolerance and
 +
acclimation and regulation of gene expression. ClpB
 +
is different from ClpA, ClpX and HslU as it does not
 +
associate with peptidase subunits. The function of ClpB
 +
is also distinct from that of other Clp ATPases: this protein
 +
is not involved in protein degradation, instead
 +
it disaggregates and reactivates strongly aggregated proteins. The aggregation reversing activity of ClpB
 +
requires cooperation with the HSP70/HSP110 chaperone
 +
machinery.
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 15:13, 29 May 2014

Please input one-sentence summary here.

==Annotated Information==ClpB-cytoplasmic (ClpB-cyt)/Hsp100 is an important chaperone protein in rice. Cellular expression of OsClpB-cyt transcript is governed by heat stress, metal stress, and developmental cues.

Function

Please input function information here. ClpB-cyt/HSP100 protein acts as chaperone, mediating disaggregation of denatured proteins. Previous studies have shown that ClpB-cyt/HSP100 gene belongs to the group class I Clp ATPase proteins and ClpB-cyt/HSP100 transcript is regulated by heat stress and developmental cues.

Expression

Please input expression information here. HSP100 is a major heat-regulated protein family in diverse organisms. Across the living systems, common features of HSP100 chaperone action include transient interactions with non-native protein species, in the prevention of aggregation and promotion of correct folding and assembly, or in unfolding for translocation or targeting to proteases. Singla and Grover showed that homologues of yeast HSP104 protein are expressed in heat shocked rice seedlings. It was subsequently established that apart from heat, rice HSP100 expression is developmentally- controlled as seeds and developing embryos of rice show high constitutive levels of this protein.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will. HSP100 proteins belong to ClpB family. Clp ATPases maintain quality of cellular proteins by performing the function of molecular chaperones and energy dependent proteases. Clp (Caseinolytic Protease) system was first identified as a heat shock inducible, multicomponent, ATP-dependent protease complex able to hydrolyze casein. Subsequent studies showed that the Clp system can hydrolyze numerous other proteins and peptides in both aggregated and non-aggregated forms Clp ATPases fall within the AAA+ superfamily of ATPases associated with a substantially broader range of biological processes. Class I ATPases (ClpA, ClpB, ClpC, ClpD) have two ATP binding domains and class II Clp ATPases (ClpM, ClpN, ClpX, ClpY) have one ATP binding domain. Clp proteins are localized in various cellular organelles in plants. Basically, Clp system members include three non-homologous gene families: ClpABCXY, ClpP and ClpQ. ClpACX members (but not ClpB) facilitate the activity of ClpP and some, such as ClpA and ClpX,can function as independent chaperones in roles analogous to those of DnaK and DnaJ proteins. In contrast, ClpP proteolytic subunit exhibits low levels of peptidolytic activity. Further, when ClpP is complexed with ClpA, ClpC or ClpX, active holoenzymes which are able to cleave denatured proteins are formed. ClpAP, ClpXP and HslUV proteases are similar in design to the eukaryotic 26 S proteasome, with the ATPase subunits guarding the entrance to the proteolytic chamber. Clp proteases in bacterial and eukaryotic systems have been implicated in vital cellular processes such as sporulation, DNA replication, protein turnover, stress tolerance and acclimation and regulation of gene expression. ClpB is different from ClpA, ClpX and HslU as it does not associate with peptidase subunits. The function of ClpB is also distinct from that of other Clp ATPases: this protein is not involved in protein degradation, instead it disaggregates and reactivates strongly aggregated proteins. The aggregation reversing activity of ClpB requires cooperation with the HSP70/HSP110 chaperone machinery.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os05g0519700

Description

Heat shock protein 101

Version

NM_001062601.1 GI:115464932 GeneID:4339343

Length

3530 bp

Definition

Oryza sativa Japonica Group Os05g0519700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:25864878..25868407

Sequence Coding Region

25865113..25865412,25865510..25865707,25865792..25866071,25866160..25866964,25867063..25868218

Expression

GEO Profiles:Os05g0519700

Genome Context

<gbrowseImage1> name=NC_008398:25864878..25868407 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:25864878..25868407 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaatccggacaacttcacgcacaagaccaacgaggcgctcgtggcggcgcacgagatagcgtcggaggcggggcacgcgcagctgacgccgctgcacctggtggcggcgctggcggcggacaagggcgggatactccggcaggcgatctcgcaggcgtccggcggggacgccggcgcgccggactcgttcgagcgcgtggtgagcggggcgctcaagaagctgccctcgcagtcgccgccgccggacagcgtgccggcgtccacggcgctgatcaaggtcatccgccgcgcgcagtccgcgcagaagaagcgcggggactcccacctcgccgtcgaccagctgctgctgggcctcctggaggactcgctaatctccgactgcctcaaggaggccggcgtgtccgcggcgcgggtgcgcgccgagctcgagaagctccgtggcggggagggccgcaaggtggagtccgcgtccggcgacaccaacttccaggcgctcaagacctacggccgcgacctcgtcgagcaggccggtaagctcgaccccgtcattggccgcgacgaggagatccgccgcgtcgtgcgcatcctgtcgcgccgcacgaagaacaaccccgtactcatcggcgagcccggcgtcggcaagacggccgtcgtggagggcctcgcgcagcgcatcgtgcgcggggacgtgcccagcaacctgctcgacgtccgcctcatcgcgctcgacatgggcgcgctcgtcgccggcgccaagtaccgcggcgagttcgaagaacggctcaaggccgtgctcaaggaggtggaggaggccgagggcaaggtgatcctcttcatcgacgagatacacctcgtcctcggcgccgggaggacggagggctccatggacgcggccaacctgttcaagccaatgctcgcgaggggccagctccggtgcatcggcgccacgacgctggaggagtaccgcaagtacgtcgagaaggacgccgcgttcgagaggcggttccagcaggtgttcgtcgcggagccgagcgtcccggacaccatcagcatcctgcgaggcctcaaggagaagtacgaggggcaccacggtgtgaggatccaggaccgcgcgctcgtcgtcgccgcgcagctctcggcgaggtacatcatgggacgccacctgcctgacaaagcgatcgacctcgtcgacgaggcctgcgcgaacgtgagggtgcagctggacagccagccagaggagatcgacaacctcgagaggaagaggattcagctggaggtggagcaccacgcgctggagaaggagaaggacaaggcaagcaaggcccggcttgtcgaggtcaagaaagagctggacgatctgagggacaagctgcagccattgacgatgaagtacaggaaggagaaggagaggatcgacgagatcaggaagctgaagcagcgccgcgaggagctccagttcacgctgcaggaggccgagcgccggatggacctcgcccgcgtcgccgacctcaagtacggcgcgctccaggagatcgacgtcgccatcgcgaagctcgagagcgagacgggggagaacctgatgctcaccgagaccgtcggccccgagcagatcgccgaggtggtgagccgctggaccggcatcccggtgacccggctcggccagaacgacaaggagaggctcgtcggcctcgccgacaggctgcaccagagggtggtcggccaggcggaggccgtgagcgccgtcgccgaggcggtgctgaggtcgcgcgccggacttggccggccgcagcagcccaccggctcgttcctcttcctcggtcccaccggcgtcggcaagaccgagctcgccaaggccctcgccgagcagctgttcgacgacgagaacctgctcgtccgcatcgacatgtccgagtacatggagcagcactccgtcgctcgcctcatcggagcaccacctggctacgtcggccatgaggaaggtgggcagctgacggagcaagtgcggcggcggccgtacagcgtgatcctgttcgacgaggtcgagaaggcgcacgtcgcggtgttcaacactctgctccaggttctcgacgacgggaggctcaccgacgggcaaggccgcacggtggacttcaggaacaccgtgatcatcatgacctccaacctcggcgccgagcacctcctcgccggcatggtcggcaagaactccatgaaggtcgcccgtgaccttgtcatgcaggaggtgaggaggcacttccgtcctgagctcctgaaccggctcgacgagattgtgatattcgatcccctgtcccacgagcaactcaggaaggtcgcccgtctccagatgaaggacgtcgccgtccggctcgccgagaggggtgtcgccctggccgtcaccgacgccgcgctggacgtcattctgtctctgtcctatgatccggtttatggcgcgaggccgatcaggaggtggatcgagaagagggtggtgacgcagctgtccaagatgctgatccaggaggagatcgacgagaactgcacggtgtacatcgacgcggcgccgcacaaggacgagctggcctacagggtggacaaccgcggggggttggtgaacgccgagacggggcagaagtcggacatcctcatccaggtgcccaacggcgccgccaccgggagcgacgccgcgcaggcggtgaagaagatgaggatcatggaggacgaggacggcatggacgaagagtag</cdnaseq>

Protein Sequence

<aaseq>MNPDNFTHKTNEALVAAHEIASEAGHAQLTPLHLVAALAADKGG ILRQAISQASGGDAGAPDSFERVVSGALKKLPSQSPPPDSVPASTALIKVIRRAQSAQ KKRGDSHLAVDQLLLGLLEDSLISDCLKEAGVSAARVRAELEKLRGGEGRKVESASGD TNFQALKTYGRDLVEQAGKLDPVIGRDEEIRRVVRILSRRTKNNPVLIGEPGVGKTAV VEGLAQRIVRGDVPSNLLDVRLIALDMGALVAGAKYRGEFEERLKAVLKEVEEAEGKV ILFIDEIHLVLGAGRTEGSMDAANLFKPMLARGQLRCIGATTLEEYRKYVEKDAAFER RFQQVFVAEPSVPDTISILRGLKEKYEGHHGVRIQDRALVVAAQLSARYIMGRHLPDK AIDLVDEACANVRVQLDSQPEEIDNLERKRIQLEVEHHALEKEKDKASKARLVEVKKE LDDLRDKLQPLTMKYRKEKERIDEIRKLKQRREELQFTLQEAERRMDLARVADLKYGA LQEIDVAIAKLESETGENLMLTETVGPEQIAEVVSRWTGIPVTRLGQNDKERLVGLAD RLHQRVVGQAEAVSAVAEAVLRSRAGLGRPQQPTGSFLFLGPTGVGKTELAKALAEQL FDDENLLVRIDMSEYMEQHSVARLIGAPPGYVGHEEGGQLTEQVRRRPYSVILFDEVE KAHVAVFNTLLQVLDDGRLTDGQGRTVDFRNTVIIMTSNLGAEHLLAGMVGKNSMKVA RDLVMQEVRRHFRPELLNRLDEIVIFDPLSHEQLRKVARLQMKDVAVRLAERGVALAV TDAALDVILSLSYDPVYGARPIRRWIEKRVVTQLSKMLIQEEIDENCTVYIDAAPHKD ELAYRVDNRGGLVNAETGQKSDILIQVPNGAATGSDAAQAVKKMRIMEDEDGMDEE</aaseq>

Gene Sequence

<dnaseqindica>2996..3295#2701..2898#2337..2616#1444..2248#190..1345#aatccactccgcccttcatatgcgcgcaccgctcctcccgttgtttccatcgacagaagagagagttcagatcaaacgccgaagcaattcttccgcaagatttcgagtgatcccatctcaatccaagctaaaccgagagattttgatttgttgctgtagattgattgtgtgaggagaggaggagcagccatgaatccggacaacttcacgcacaagaccaacgaggcgctcgtggcggcgcacgagatagcgtcggaggcggggcacgcgcagctgacgccgctgcacctggtggcggcgctggcggcggacaagggcgggatactccggcaggcgatctcgcaggcgtccggcggggacgccggcgcgccggactcgttcgagcgcgtggtgagcggggcgctcaagaagctgccctcgcagtcgccgccgccggacagcgtgccggcgtccacggcgctgatcaaggtcatccgccgcgcgcagtccgcgcagaagaagcgcggggactcccacctcgccgtcgaccagctgctgctgggcctcctggaggactcgctaatctccgactgcctcaaggaggccggcgtgtccgcggcgcgggtgcgcgccgagctcgagaagctccgtggcggggagggccgcaaggtggagtccgcgtccggcgacaccaacttccaggcgctcaagacctacggccgcgacctcgtcgagcaggccggtaagctcgaccccgtcattggccgcgacgaggagatccgccgcgtcgtgcgcatcctgtcgcgccgcacgaagaacaaccccgtactcatcggcgagcccggcgtcggcaagacggccgtcgtggagggcctcgcgcagcgcatcgtgcgcggggacgtgcccagcaacctgctcgacgtccgcctcatcgcgctcgacatgggcgcgctcgtcgccggcgccaagtaccgcggcgagttcgaagaacggctcaaggccgtgctcaaggaggtggaggaggccgagggcaaggtgatcctcttcatcgacgagatacacctcgtcctcggcgccgggaggacggagggctccatggacgcggccaacctgttcaagccaatgctcgcgaggggccagctccggtgcatcggcgccacgacgctggaggagtaccgcaagtacgtcgagaaggacgccgcgttcgagaggcggttccagcaggtgttcgtcgcggagccgagcgtcccggacaccatcagcatcctgcgaggcctcaaggagaagtacgaggggcaccacggtgtgaggatccaggaccgcgcgctcgtcgtcgccgcgcagctctcggcgaggtacatcatgggtaagttgctcctgccgtccttgccattgccattgccaacctacattgtcaagctcgagttcacattcttgtgccatttctgctctgtaattcttcaggacgccacctgcctgacaaagcgatcgacctcgtcgacgaggcctgcgcgaacgtgagggtgcagctggacagccagccagaggagatcgacaacctcgagaggaagaggattcagctggaggtggagcaccacgcgctggagaaggagaaggacaaggcaagcaaggcccggcttgtcgaggtcaagaaagagctggacgatctgagggacaagctgcagccattgacgatgaagtacaggaaggagaaggagaggatcgacgagatcaggaagctgaagcagcgccgcgaggagctccagttcacgctgcaggaggccgagcgccggatggacctcgcccgcgtcgccgacctcaagtacggcgcgctccaggagatcgacgtcgccatcgcgaagctcgagagcgagacgggggagaacctgatgctcaccgagaccgtcggccccgagcagatcgccgaggtggtgagccgctggaccggcatcccggtgacccggctcggccagaacgacaaggagaggctcgtcggcctcgccgacaggctgcaccagagggtggtcggccaggcggaggccgtgagcgccgtcgccgaggcggtgctgaggtcgcgcgccggacttggccggccgcagcagcccaccggctcgttcctcttcctcggtcccaccggcgtcggcaagaccgagctcgccaaggccctcgccgagcagctgttcgacgacgagaacctgctcgtccgcatcgacatgtccgagtacatggagcagcactccgtcgctcgcctcatcggagcaccacctgggtaagtatcaatcccaatgttgttttcacagttcttgcaaccgaatttcgggtgctgacatgggggaaatttctctctctgaatgaagctacgtcggccatgaggaaggtgggcagctgacggagcaagtgcggcggcggccgtacagcgtgatcctgttcgacgaggtcgagaaggcgcacgtcgcggtgttcaacactctgctccaggttctcgacgacgggaggctcaccgacgggcaaggccgcacggtggacttcaggaacaccgtgatcatcatgacctccaacctcggcgccgagcacctcctcgccggcatggtcggcaagaactccatgaaggtcgcccgtgaccttgtcatgcaggaggtatgtatggccttttgctttccacaaccatggattcatttgcaatgcaatgcgatgctgaattgatttcgatattttgtgcaggtgaggaggcacttccgtcctgagctcctgaaccggctcgacgagattgtgatattcgatcccctgtcccacgagcaactcaggaaggtcgcccgtctccagatgaaggacgtcgccgtccggctcgccgagaggggtgtcgccctggccgtcaccgacgccgcgctggacgtcattctgtctctgtcctatgatccggtacgcgacagcatccaactatcaggtcgaagtttttcaaagaaattctcgtcgaatttgattctaactctctctgtgactctggtactacgtacaggtttatggcgcgaggccgatcaggaggtggatcgagaagagggtggtgacgcagctgtccaagatgctgatccaggaggagatcgacgagaactgcacggtgtacatcgacgcggcgccgcacaaggacgagctggcctacagggtggacaaccgcggggggttggtgaacgccgagacggggcagaagtcggacatcctcatccaggtgcccaacggcgccgccaccgggagcgacgccgcgcaggcggtgaagaagatgaggatcatggaggacgaggacggcatggacgaagagtagtaagtagtagagcgcgtatgtgcgtgttgcgcccccgggcagaggcagaggagggcgccgatcgagctgtgtgaatgaatgtggggtgtctccgttgaataagctgtgaaatatggtgtttttccgatgatgcctttttgtgaagttgttgttctgctaagacgactttcttttgtgaaatttctgatgaactgaagaagtgtaaaaacgtttacgttctggttgagttgagttg</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0519700, RefSeq:Os05g0519700