Difference between revisions of "Os10g0478000"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
  The rice ''TAWAWA1 (TAW1)'' gene is a member of ALOG family, was identified as a  regulator of rice inflorescence architecture.
+
  The rice ''TAWAWA1 (TAW1)'' gene is a member of ALOG family, and was identified as a  regulator of rice inflorescence architecture.
  
 
==Annotated Information==
 
==Annotated Information==

Revision as of 03:10, 30 May 2014

The rice TAWAWA1 (TAW1) gene is a member of ALOG family, and was identified as a  regulator of rice inflorescence architecture.

Annotated Information

Function

In the dominant gain-of-function mutant tawawa1-D, the activity of the inflorescence meristem (IM) is extended and spikelet specification is delayed, resulting in prolonged branch formation and increased numbers of spikelets. In contrast, reductions in TAWAWA1 (TAW1) activity cause precocious IM abortion and spikelet formation, resulting in the generation of small inflorescences. TAW1 encodes a nuclear protein of unknown function and shows high levels of expression in the shoot apical meristem, the IM, and the branch meristem (BMs). TAW1 expression disappears from incipient spikelet meristems (SMs). It is demonstrated that members of the SHORT VEGETATIVE PHASE subfamily of MADS-box genes function downstream of TAW1.Thus, TAW1 is proposed as a unique regulator of meristem activity in rice and regulates inflorescence development through the promotion of IM activity and suppression of the phase change to SM identity [1].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

  • Graduate School of Agriculture and Life Sciences, The University of Tokyo, Yayoi, Bunkyo, Tokyo 113-8657, Japan

References

<references> [1]

Structured Information

Gene Name

Os10g0478000

Description

Protein of unknown function DUF640 domain containing protein

Version

NM_001189280.1 GI:297727690 GeneID:9266624

Length

1426 bp

Definition

Oryza sativa Japonica Group Os10g0478000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:18345508..18346933

Sequence Coding Region

18345710..18346324

Expression

GEO Profiles:Os10g0478000

Genome Context

<gbrowseImage1> name=NC_008403:18345508..18346933 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:18345508..18346933 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagttcgtggcgcacgcggcggcgccggacagcccgcactcggacagcggcggaggaggagggggaatggcgacgggggcgacgtcggcgtcggcggcgggggcgtcgccgagcaggtacgagtcgcagaagcggcgggactggaacacgttcgggcagtacctccgcaaccaccggccgccgctgtcgctggcgcggtgcagcggcgcgcacgtcctggagttcctccgctacctggaccagttcggcaagaccaaggtgcacgcgccggcgtgccccttcttcggccacccggcgccgccggcgccgtgcccgtgcccgcttcgccaggcgtggggcagcctcgacgccctcgtcggccgcctccgcgccgcctacgaggagaacggcggccgccccgagaacaaccccttcggcgcccgcgccgtccgcctctacctccgcgaggtccgcgagcaccaggcgcgcgcacgcggcgtcagctacgagaagaagaagcgcaagaagccaccccacccctcctccgccgccgccgcgcacgacgacgccgccaacggcgccctccaccaccaccaccacatgccgccgcctcctcccggcgccgccgcctga</cdnaseq>

Protein Sequence

<aaseq>MEFVAHAAAPDSPHSDSGGGGGGMATGATSASAAGASPSRYESQ KRRDWNTFGQYLRNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHAPACPFFGHPAPP APCPCPLRQAWGSLDALVGRLRAAYEENGGRPENNPFGARAVRLYLREVREHQARARG VSYEKKKRKKPPHPSSAAAAHDDAANGALHHHHHMPPPPPGAAA</aaseq>

Gene Sequence

<dnaseqindica>610..1224#tatcggctccttctcgcccagcttttgctcacgtcacatcaccttccacctccacccctccactcgctcgctcgcttgcttgctccaattaatacctcttctccttctcccccagcaactagcttccttctccgcttttgcagctcgccgccgccgccgccgccgccgccgcgacacggcgcgcatatggtcgtcgtcgtcgtcgtcgtcgtcgctggagaagacgaagaaagatagtagacctgagctgggggggcggtgaattcgccggagagctagctaaggtgagtttcgttttcggtttcggtttcgatcgatttgttggtgcagatgcatctgggagctagagaactatttatagtggctgcggtgcggtgcggcgtcgccacgccgcgcacgcgctcgcccacgtcgcgcgcgcgcgggcgcgcgtccactctctctctctcttggaccactgcgcgcgcgggcgcgcgtcggcgtcgccacggcttctcaagaacgcgcgcgcgcgcactgattcccagatagatagatctatatctgttcgtcttcctcagctatggtgtggtggtggtggtggtgtttgtggtgttgtgcagatcgacgatggagttcgtggcgcacgcggcggcgccggacagcccgcactcggacagcggcggaggaggagggggaatggcgacgggggcgacgtcggcgtcggcggcgggggcgtcgccgagcaggtacgagtcgcagaagcggcgggactggaacacgttcgggcagtacctccgcaaccaccggccgccgctgtcgctggcgcggtgcagcggcgcgcacgtcctggagttcctccgctacctggaccagttcggcaagaccaaggtgcacgcgccggcgtgccccttcttcggccacccggcgccgccggcgccgtgcccgtgcccgcttcgccaggcgtggggcagcctcgacgccctcgtcggccgcctccgcgccgcctacgaggagaacggcggccgccccgagaacaaccccttcggcgcccgcgccgtccgcctctacctccgcgaggtccgcgagcaccaggcgcgcgcacgcggcgtcagctacgagaagaagaagcgcaagaagccaccccacccctcctccgccgccgccgcgcacgacgacgccgccaacggcgccctccaccaccaccaccacatgccgccgcctcctcccggcgccgccgcctgagccgagccgagcttgctccaagatcgccggaaaacgagctgctagcctcctacgcatgcactagttactccactccactccactccactatgatccctagctaggctgctcttgctactagcaaaactacggattaatctccatgcttgctactgctgctgctgctgctactgcatctaattaattaggttgattatttcct</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0478000, RefSeq:Os10g0478000

  1. 1.0 1.1 Yoshida A, Sasao M, Yasuno N, et al. (2013) TAWAWA1, a regulator of rice inflorescence architecture, functions through the suppression of meristem phase transition. Proceedings of the National Academy of Sciences 110: 767-772.