Difference between revisions of "Os11g0210300"

From RiceWiki
Jump to: navigation, search
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
[[File:Sjc-Fig1.jpg|right|thumb|150px|''Diagram of alcoholic fermentation pathway in plants. (from reference <ref name="ref13" />).'']]
+
[[File:Sjc-Fig1.jpg|right|thumb|200px|''Diagram of alcoholic fermentation pathway in plants. (from reference <ref name="ref13" />).'']]
  
 
In many higher plants, alcoholic fermentation is necessary for germination and survival under anaerobic conditions caused by heavy rain and flooding <ref name="ref1" />. Alcoholic fermentation occurs in two reaction steps: the decarboxylation of pyruvate to acetaldehyde by pyruvate decarboxylase (PDC) and the subsequent reduction of acetaldehyde to ethanol by lcohol dehydrogenase (ADH). This metabolic pathway supports glycolysis and ATP synthesis by recycling NAD+. Analyses of ADH deficient mutants in maize <ref name="ref2" /><ref name="ref3" /><ref name="ref4" />, barley <ref name="ref5" />, Arabidopsis <ref name="ref6" /><ref name="ref7" /> and rice <ref name="ref8" /> have shown that ADH is required for anaerobic tolerance in plants.  
 
In many higher plants, alcoholic fermentation is necessary for germination and survival under anaerobic conditions caused by heavy rain and flooding <ref name="ref1" />. Alcoholic fermentation occurs in two reaction steps: the decarboxylation of pyruvate to acetaldehyde by pyruvate decarboxylase (PDC) and the subsequent reduction of acetaldehyde to ethanol by lcohol dehydrogenase (ADH). This metabolic pathway supports glycolysis and ATP synthesis by recycling NAD+. Analyses of ADH deficient mutants in maize <ref name="ref2" /><ref name="ref3" /><ref name="ref4" />, barley <ref name="ref5" />, Arabidopsis <ref name="ref6" /><ref name="ref7" /> and rice <ref name="ref8" /> have shown that ADH is required for anaerobic tolerance in plants.  
Line 10: Line 10:
  
 
===Expression===
 
===Expression===
[[File:Sjc-Fig2.jpg|right|thumb|150px|''Comparison of coleoptiles of wild type rice and the rad mutant. (from reference <ref name="ref13" />).'']]
+
[[File:Sjc-Fig2.jpg|right|thumb|300px|''Comparison of coleoptiles of wild type rice and the rad mutant. (from reference <ref name="ref13" />).'']]
  
 
Under submerged conditions, the coleoptiles of the wild type Kinmaze began to elongate one day after imbibition and reached an average length of 52.2 mm after 5 days. However, the coleoptiles ofthe rad mutant hardly elongated even after 5 days. This result was consistent with the findings of <ref name="ref12" />. The relative transcript levels of Adh] in the coleoptile were comparable between the rad mutant and Kinmaze, while the amount of ADH protein in the coleoptiles in the radmutant was 5-fold lower than that in Kinmaze. These results were similar to those observed in the leaves and roots ofthe rad mutant <ref name="ref8" />. On the other hand, the Pdc1 mRNA levels and the PDC protein levels were comparable between the rad mutant and Kinmaze, suggesting that the expression of the Pdc1 gene was not affected by the reduction ofthe ADH protein level.
 
Under submerged conditions, the coleoptiles of the wild type Kinmaze began to elongate one day after imbibition and reached an average length of 52.2 mm after 5 days. However, the coleoptiles ofthe rad mutant hardly elongated even after 5 days. This result was consistent with the findings of <ref name="ref12" />. The relative transcript levels of Adh] in the coleoptile were comparable between the rad mutant and Kinmaze, while the amount of ADH protein in the coleoptiles in the radmutant was 5-fold lower than that in Kinmaze. These results were similar to those observed in the leaves and roots ofthe rad mutant <ref name="ref8" />. On the other hand, the Pdc1 mRNA levels and the PDC protein levels were comparable between the rad mutant and Kinmaze, suggesting that the expression of the Pdc1 gene was not affected by the reduction ofthe ADH protein level.

Revision as of 05:58, 30 May 2014

Adh1 gene locus, elongating coleoptile when rice in flooded conditions.

Annotated Information

Function

File:Sjc-Fig1.jpg
Diagram of alcoholic fermentation pathway in plants. (from reference [1]).

In many higher plants, alcoholic fermentation is necessary for germination and survival under anaerobic conditions caused by heavy rain and flooding [2]. Alcoholic fermentation occurs in two reaction steps: the decarboxylation of pyruvate to acetaldehyde by pyruvate decarboxylase (PDC) and the subsequent reduction of acetaldehyde to ethanol by lcohol dehydrogenase (ADH). This metabolic pathway supports glycolysis and ATP synthesis by recycling NAD+. Analyses of ADH deficient mutants in maize [3][4][5], barley [6], Arabidopsis [7][8] and rice [9] have shown that ADH is required for anaerobic tolerance in plants. When rice germinates under water, ADH activity is required for coleoptile elongation [10][11] [12]. Matsumura et al. [13] isolated a single recessive rice mutant, whose ADH activity was markedly reduced. Thus, the mutant was designated as reduced adh activity (rad) mutant. Elongation of the coleoptile was strongly repressed in the submerged rad mutant [13]. Subsequently, the amount of ADHl protein, but not the amount of ADH2 protein, in shoots and roots in the rad mutant was found to be lower than that in the wild type, while the Adhl mRNA levels in the rad mutant were comparable to those in the wild type [9]. The rad Adhl gene displayed a point mutation linked to the phenotype ofrepressed coleoptile elongation.

Expression

File:Sjc-Fig2.jpg
Comparison of coleoptiles of wild type rice and the rad mutant. (from reference [1]).

Under submerged conditions, the coleoptiles of the wild type Kinmaze began to elongate one day after imbibition and reached an average length of 52.2 mm after 5 days. However, the coleoptiles ofthe rad mutant hardly elongated even after 5 days. This result was consistent with the findings of [13]. The relative transcript levels of Adh] in the coleoptile were comparable between the rad mutant and Kinmaze, while the amount of ADH protein in the coleoptiles in the radmutant was 5-fold lower than that in Kinmaze. These results were similar to those observed in the leaves and roots ofthe rad mutant [9]. On the other hand, the Pdc1 mRNA levels and the PDC protein levels were comparable between the rad mutant and Kinmaze?, suggesting that the expression of the Pdc1 gene was not affected by the reduction ofthe ADH protein level.


Labs working on this gene

Laboratory of Plant Molecular Genetics, Graduate School of Agricultural and Life Sciences, The University of Tokyo, 1-1-1 Yayoi, Bunkyo, Tokyo 113-8657, Japan

References

<references> [2] [3] [4] [5] [6] [7] [8] [9] [10] [11] [12] [13] [1]

Structured Information

Gene Name

Os11g0210300

Description

Alcohol dehydrogenase 1

Version

NM_001074016.1 GI:115484680 GeneID:4350053

Length

3618 bp

Definition

Oryza sativa Japonica Group Os11g0210300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:5695598..5699215

Sequence Coding Region

5695953..5696069,5696229..5696390,5696473..5696568,5696649..5696710,5696792..5696867
,5696947..5697029,5697115..5697440,5698270..5698316,5698414..5698550
,5698810..5698843

Expression

GEO Profiles:Os11g0210300

Genome Context

<gbrowseImage1> name=NC_008404:5695598..5699215 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:5695598..5699215 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgaccgcagggaaggtgatcaagtgcaaagcggcggtggcatgggaggccgcgaagccgctggtgatcgaggaggtggaggtggcgccgccgcaggccatggaggtgcgcgtcaagatcctcttcacctcgctctgccacaccgacgtctacttctgggaggccaagggacagactcccgtgttccctcggatcttcggccatgaagctggaggtattgtggagagtgttggagagggtgtgactgatcttgcccctggtgaccatgttctccctgtgttcactggggagtgcaaggagtgtgcccactgcaagtcagcagagagcaacatgtgtgatctgctcaggatcaacactgacaggggtgtgatgattggtgatggcaaatcacgcttttccatcaacgggaagcccatttaccatttcgtcgggacttcgaccttcagcgagtacactgtcatgcatgttggttgcgttgcgaagatcaacccggcagctccacttgataaagtttgcgttcttagctgtggtatttctactggtcttggtgctacaatcaatgtggcaaagccaccaaagggttcgacggtggcgatatttggtctaggagctgtaggccttgctgccgcagaaggtgcaaggattgcaggagcgtcaaggatcattggcattgacctgaacgccaacagatttgaagaagctaggaaatttggttgcactgaatttgtgaacccaaaggaccatgacaagccagttcagcaggtacttgctgagatgaccaatggcggagttgaccgcagcgttgaatgcactggcaacatcaacgccatgatccaagcatttgaatgtgttcatgatggctggggtgttgctgttttggtcggcgtgccacacaaggacgccgagttcaagacccacccgatgaacttcctgaacgagaggactctcaagggaaccttcttcggcaactacaagccacgcaccgatctgcccaacgtcgtcgagctctacatgaagaaggagctggaggtggagaagttcatcacacacagcgtgccgttctcggagatcaacacggcgttcgacctgatgcacaagggcgagggcatccgctgcatcatccgcatggagaactga</cdnaseq>

Protein Sequence

<aaseq>MATAGKVIKCKAAVAWEAAKPLVIEEVEVAPPQAMEVRVKILFT SLCHTDVYFWEAKGQTPVFPRIFGHEAGGIVESVGEGVTDLAPGDHVLPVFTGECKEC AHCKSAESNMCDLLRINTDRGVMIGDGKSRFSINGKPIYHFVGTSTFSEYTVMHVGCV AKINPAAPLDKVCVLSCGISTGLGATINVAKPPKGSTVAIFGLGAVGLAAAEGARIAG ASRIIGIDLNANRFEEARKFGCTEFVNPKDHDKPVQQVLAEMTNGGVDRSVECTGNIN AMIQAFECVHDGWGVAVLVGVPHKDAEFKTHPMNFLNERTLKGTFFGNYKPRTDLPNV VELYMKKELEVEKFITHSVPFSEINTAFDLMHKGEGIRCIIRMEN</aaseq>

Gene Sequence

<dnaseqindica>3147..3263#2826..2987#2648..2743#2506..2567#2349..2424#2187..2269#1776..2101#900..946#666..802#373..406#gccggccgtcgcgcatccgacggccactcaccatcggcgtcgggggaggcgaaaacagcggctgcaattccgcttccaggtggagggggaggaggcccggtttgtgtgccacgccgccccactccgtccgtggtttgctacccaagaagacaagaagaaggaagtggcgaaacctcaccctccatcctccatcctctcctttcttccttcgaggaggaggagctatatatagacggggatggttcatctagcctcctcaccggttttgatttgatctgtgtgatttgagtgagtgagtgagattctttggaggagggattttggtttggtttggtttggtggtttgtgcgggattttgtggggaggagagtaatggcgaccgcagggaaggtgatcaagtgcaaaggtcagtgcttttcctcccctccctgtttcttcttggttcgattttgctttggattgggcgaacttttaggcattttattactggagcggcgctgtagatgaaattcttggattgtgttctttttagagttttcttgggtgaacattaccgatcttgcagaagctgtggagaaaagcatatctttttttttagtgaaaaatgtcattcaggattatgtttttttggtggattggtgggtgattttgctggatctgtgcagcggcggtggcatgggaggccgcgaagccgctggtgatcgaggaggtggaggtggcgccgccgcaggccatggaggtgcgcgtcaagatcctcttcacctcgctctgccacaccgacgtctacttctgggaggccaaggtatctactcacctcctcttcttcagttcctatccatccatagctgctccaatgtgtggttgacttgcgcctcttgtgtggcttctgaatctcttagggacagactcccgtgttccctcggatcttcggccatgaagctggagggtatgtgcttttatgcatcttcttccttgattttgtttcttgttaatacttggttgctctgatgcatgcttttgttgctgatgtgtgatgtggcatgctgttagttaattgatttgttgttactacctggttactccactgttgtggttgctagtgtggcctgttgttaattaattgattctttgttagtactacttggttactctgctgctctggttgctggtgtgttgtgttgttaattaattggctcgttgttacttcttggtttactctactgctctggttgctgatgtggcatgttgttaagtacttaaaactatgctttgtggttgaatcttcctctaattgcagtttagggggggggttcattgtttattggcttggcattagtagaacatttggctgaggtaatctggacaacatgggaaagaatcatatgggcacatgctgttgcctgtgtcaaacattataaatgtgtgctttttttgtgggtcttcagttggatcttgatagatttatcaatttataacttattacaaggaagaaactttttctttcagttagtagttggtagtttatttttgaagttggcagatttatttgtgataggcgttgattgaccctttagaagacttctcttcaataagtttgtattttccagttgacaaagggcatataaattaggcattgcttgacctttatgctacctaacatattcatggtaccctttctattttctgaaatacagcgtggattattttttttaacacttccattgagtaaaagattcctattgttcatatctgctgaaatttattcatttctgcagtattgtggagagtgttggagagggtgtgactgatcttgcccctggtgaccatgttctccctgtgttcactggggagtgcaaggagtgtgcccactgcaagtcagcagagagcaacatgtgtgatctgctcaggatcaacactgacaggggtgtgatgattggtgatggcaaatcacgcttttccatcaacgggaagcccatttaccatttcgtcgggacttcgaccttcagcgagtacactgtcatgcatgttggttgcgttgcgaagatcaacccggcagctccacttgataaagtttgcgttcttagctgtggtatttctactggtaagcagaattttttttgtttcttgcattcttcttacttgatagaatgtaagttgagatgctgagtcgcaatttccttttgtaggtcttggtgctacaatcaatgtggcaaagccaccaaagggttcgacggtggcgatatttggtctaggagctgtaggccttgctgtgagtgtctgaactcaccttgaatgttctcaattacaatgagagatccatctaattactctacatattgtctgattaggccgcagaaggtgcaaggattgcaggagcgtcaaggatcattggcattgacctgaacgccaacagatttgaagaaggtaaaatcctcttgatttaccagatcatcagtttgtttgatggtcttttaaagtcatcttatatattttgtatatcttcagctaggaaatttggttgcactgaatttgtgaacccaaaggaccatgacaagccagttcagcaggtatgtatgttcccttacatcaggaaaaggaaaatctgtatcacttgattgtactgatacagtgtgttatggtaatttaggtacttgctgagatgaccaatggcggagttgaccgcagcgttgaatgcactggcaacatcaacgccatgatccaagcatttgaatgtgttcatgatgtaagatctgaaaacagcatattgtccacttaatacagttaattcgacaagatgctaaatatattatatgttctgaatccagggctggggtgttgctgttttggtcggcgtgccacacaaggacgccgagttcaagacccacccgatgaacttcctgaacgagaggactctcaagggaaccttcttcggcaactacaagccacgcaccgatctgcccaacgtcgtcgagctctacatgaagaaggtgaatacaaatcgcgaatccttcctttcgctttatccaactattacaaactaagagtagtcgcaaaatcttcaaatgttcatcgacctcaatcaagaacttctgaaagttgggtgtgtccatgctcttatatgcatacctccgctgttgtgaattcaggagctggaggtggagaagttcatcacacacagcgtgccgttctcggagatcaacacggcgttcgacctgatgcacaagggcgagggcatccgctgcatcatccgcatggagaactgaggtttttcaggggattatggtgttgggtaataagattgggcagcttgagcagcctgccttgggtgaatgatgatatacggttcttctgtgtatcctgggcaaatttctggctttgtcaatcagtaatagtacggtatgaattccagtgtctgtagctgcaaagagtttgttaagaatcagtgatcttttggcgtaatattatcatatatttatacgagtttcagttcgtcaccctcttcacttttcagaacttttttaagtcttatgacttcagagccaccaaacgtgctgtttttgaattccatggtggcttgaatttggtacatgttcatgtaaatgtgggatatttgtcatc</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0210300, RefSeq:Os11g0210300

  1. 1.0 1.1 1.2 Hiroaki,S., H. Matsumura, T. Takano, N. Tsutsumi and M. Nakazono (2006) A Point Mutation ofAdhl Gene is Involved in the Repression of Coleoptile Elongation under Submergence in Rice. Breed. Sci. 56: 69-74
  2. 2.0 2.1 Tadege,M., I.Dupuis and C.Kuhlemeier (1999) Ethanolic fermentation: new functions for an old pathway. Trends Plant Sci. 4: 320-325.
  3. 3.0 3.1 Schwartz,D. (1969) An example of gene fixation resulting from selective advantage in suboptimal conditions. Am. Nat. 103: 479-481.
  4. 4.0 4.1 Freeling,M. and D.C.Bennett (1985) Maize Adhl. Ann. Rev. Genet.19: 297-323.
  5. 5.0 5.1 Johnson,J.R., B.G.Cobb and M.C.Drew (1994) Hypoxic induction of anoxia tolerance in roots of Adh] null Zea mays L. Plant Physiol. 105: 61-67.
  6. 6.0 6.1 Harberd,N.P. and K.J.R. Edwards (1982) The effect of a mutation causing alcohol dehydrogenase deficiency on flooding tolerance in barley. New Phytol. 90: 631-644.
  7. 7.0 7.1 Jacobs,M., R.Dolferus and D.VandenBossche (1988) Isolation and biochemical analysis of ethyl methanesulfonate-induced alcohol dehydrogenase null mutants of Arabidopsis thaliana (L.) Heynh. Biochem. Genet. 26: 105-122.
  8. 8.0 8.1 Ellis M.H., E.S.Dennis and W.J.Peacock (1999) Arabidopsis roots and shoots have different mechanisms for hypoxic stress tolerance.Plant Physiol. 119: 57-64.
  9. 9.0 9.1 9.2 9.3 Matsumura,H., T.Takano, G.Takeda and H.Uchimiya (1998) Adh1 is transcriptionally active but its translational product is reduced in a rad mutant of rice (Oryza sativa L.), which is vulnerable to submergence stress. Theor. Appl. Genet. 97: 1197-1203.
  10. 10.0 10.1 Setter,T.L. and E.S.Ella (1994) Relationship between coleoptile elongation and alcoholic fermentation in rice exposed to anoxia.I.Importance of treatment conditions and different tissues. Ann.Bot. 74: 265 271.
  11. 11.0 11.1 Kato-Noguchi,H. (2001) Submergence tolerance and ethanolic fermentation in rice coleoptiles. Plant Prod. Sci. 4: 62-65.
  12. 12.0 12.1 Kato-Noguchi,H. and T.Kugimiya (2003) Preferential induction of alcohol dehydrogenase in coleoptiles of rice seedlings germinated in submergence condition. Biol. Plant. 46: 153-155.
  13. 13.0 13.1 13.2 13.3 Matsumura,H., T.Takano, K.T.Yoshida and G.Takeda (1995) A rice mutant lacking Alcohol-dehydrogenase. Breed. Sci. 45: 365-367.(1995)