Difference between revisions of "Os02g0698800"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Labs working on this gene)
Line 15: Line 15:
 
Key Laboratory of Tropical Forest Ecology, Xishuangbanna Tropical Botanical Garden, Chinese Academy of Sciences, Yunnan, China.
 
Key Laboratory of Tropical Forest Ecology, Xishuangbanna Tropical Botanical Garden, Chinese Academy of Sciences, Yunnan, China.
 
Department of Biology and Microbiology, South Dakota State University, Brookings, SD 57007, USA.
 
Department of Biology and Microbiology, South Dakota State University, Brookings, SD 57007, USA.
 +
Max-Plank-Institute for Plant Breeding Research, Department of Plant-Microbe Interactions, Carl-von-Linné Weg 10, D-50829 Köln, Germany.
  
 
==References==
 
==References==

Revision as of 08:09, 30 May 2014

Please input one-sentence summary here.

Annotated Information

Function

WRKY transcription factors (TFs) are key regulators of many plant processes, including the responses to biotic and abiotic stresses, senescence, seed dormancy and seed germination. For over 15 years, limited evidence has been available suggesting that WRKY TFs may play roles in regulating plant responses to the phytohormone abscisic acid (ABA), notably some WRKY TFs are ABA-inducible repressors of seed germination. However, the roles of WRKY TFs in other aspects of ABA signalling, and the mechanisms involved, have remained unclear. Recent significant progress in ABA research has now placed specific WRKY TFs firmly in ABA-responsive signalling pathways, where they act at multiple levels. In Arabidopsis, WRKY TFs appear to act downstream of at least two ABA receptors: the cytoplasmic PYR/PYL/RCAR-protein phosphatase 2C-ABA complex and the chloroplast envelope-located ABAR-ABA complex. In vivo and in vitro promoter-binding studies show that the target genes for WRKY TFs that are involved in ABA signalling include well-known ABA-responsive genes such as ABF2, ABF4, ABI4, ABI5, MYB2, DREB1a, DREB2a and RAB18. Additional well-characterized stress-inducible genes such as RD29A and COR47 are also found in signalling pathways downstream of WRKY TFs. These new insights also reveal that some WRKY TFs are positive regulators of ABA-mediated stomatal closure and hence drought responses. Conversely, many WRKY TFs are negative regulators of seed germination, and controlling seed germination appears a common function of a subset of WRKY TFs in flowering plants. Taken together, these new data demonstrate that WRKY TFs are key nodes in ABA-responsive signalling networks.

Expression

Please input expression information here.

Evolution

New findings illustrate that WRKY proteins often act as repressors as well as activators, and that members of the family play roles in both the repression and de-repression of important plant processes. Furthermore, it is becoming clear that a single WRKY transcription factor might be involved in regulating several seemingly disparate processes. Mechanisms of signalling and transcriptional regulation are being dissected, uncovering WRKY protein functions via interactions with a diverse array of protein partners, including MAP kinases, MAP kinase kinases, 14-3-3 proteins, calmodulin, histone deacetylases, resistance proteins and other WRKY transcription factors. WRKY genes exhibit extensive autoregulation and cross-regulation that facilitates transcriptional reprogramming in a dynamic web with built-in redundancy.

Labs working on this gene

Department of Biology and Microbiology, South Dakota State University, Brookings, SD, USA. Key Laboratory of Tropical Forest Ecology, Xishuangbanna Tropical Botanical Garden, Chinese Academy of Sciences, Yunnan, China. Department of Biology and Microbiology, South Dakota State University, Brookings, SD 57007, USA. Max-Plank-Institute for Plant Breeding Research, Department of Plant-Microbe Interactions, Carl-von-Linné Weg 10, D-50829 Köln, Germany.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0698800

Description

WRKY transcription factor 66

Version

NM_001054362.1 GI:115448094 GeneID:4330420

Length

4149 bp

Definition

Oryza sativa Japonica Group Os02g0698800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:29613644..29617792

Sequence Coding Region

29613699..29614333,29614965..29615105,29616994..29617738

Expression

GEO Profiles:Os02g0698800

Genome Context

<gbrowseImage1> name=NC_008395:29613644..29617792 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:29613644..29617792 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtgtgattacttcttgcaacggatggagggggagcaggccgccggagacctcgccgacatcgtcctccgcgccggcggggctgctgctgctgctgttgcgggcggcggcatcccgtcgacggagtggcagctaccaccggcggaggaggaggaggaagagccgggtctcttcccgctgccgccgtcgtcgtcggatggctccggcatgagcggcgcggatgcgttcggcgacccgttcgctggcctccccgaccccttcggtggcgactacccctcctctggcggagcggcggcggccgccgacttctttgacgccgtcgtggccaaggccgggttcgtcgacgtcggtgtcctcggtggcggcggcggcggtggctgcgatggaggtggcgttgatggtggtggaggagggtcgtcgctgctgggcatgagcaagcctatcttgcctagggccgccatgcagttgccgtcggtgtcgccgagggcgatacggccgtaccccgtgatggccggtgacacggtgaagctcggcgcgccgatggccggcgggccgtgcgcgttcgacggcgccgccgcggcagggctgcacatgtcgtcgtcgccgcgtggcgccgtcggcgggatcaagcgcaggaagaaccaggctaggaaggtggtgtgcatcccagcgcctgcagcagcaggagggaggaccagtggggaggttgttccttccgatctctgggcttggaggaagtatggccagaagcctatcaaaggctctccttacccaagagggtactacagatgcagcagctcgaaaggatgctcggcgcgcaagcaggtggagcgcagccggaccgaccccaacatgctcgtcatcacctacacgtcggagcacaaccacccgtggccgacgcagcgcaacgcgctcgccggctccacgcggtctcatcacgccaagaacagcagcagcaacagcagcagcagcggcgcctcctcagcctccaagaacaactcctcccacagcggttaccaccaccaccaccaccagaagccactcgtcaaggcggaacccaacgatcaatccgccgccgccacgaccgccgccacggtgccggtgaaagaggaggccgccatggtagggacgtcgtcggaagcattggcgaagacgacgcagaaatccatggaggatgctgctgctgctgcttcagccacggcggcggcggtggagcacagtgatctcatgcagcagatgttcagccagagctaccggccgatgataccggaggcagcggccggcggccaccacgacgacttcttcgccgacctcgccgagttggagtcagatcccatgagcctgatcttctccaaggagtacatggcgaccaattacaagccagcaggtgacccagcaggcaaggagatgaatgcagtagacaagggcttggatccagcgtacatgctggattggtcttctaccactgttgttactagagctggtgggagctcatttatgcaaggggagggaggtttatga</cdnaseq>

Protein Sequence

<aaseq>MCDYFLQRMEGEQAAGDLADIVLRAGGAAAAAVAGGGIPSTEWQ LPPAEEEEEEPGLFPLPPSSSDGSGMSGADAFGDPFAGLPDPFGGDYPSSGGAAAAAD FFDAVVAKAGFVDVGVLGGGGGGGCDGGGVDGGGGGSSLLGMSKPILPRAAMQLPSVS PRAIRPYPVMAGDTVKLGAPMAGGPCAFDGAAAAGLHMSSSPRGAVGGIKRRKNQARK VVCIPAPAAAGGRTSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCSARKQV ERSRTDPNMLVITYTSEHNHPWPTQRNALAGSTRSHHAKNSSSNSSSSGASSASKNNS SHSGYHHHHHQKPLVKAEPNDQSAAATTAATVPVKEEAAMVGTSSEALAKTTQKSMED AAAAASATAAAVEHSDLMQQMFSQSYRPMIPEAAAGGHHDDFFADLAELESDPMSLIF SKEYMATNYKPAGDPAGKEMNAVDKGLDPAYMLDWSSTTVVTRAGGSSFMQGEGGL</aaseq>

Gene Sequence

<dnaseqindica>56..690#1322..1462#3351..4095#gcgagcgtcagagagagagagagagagaggaggtggtggtggtggtcagatcatcatgtgtgattacttcttgcaacggatggagggggagcaggccgccggagacctcgccgacatcgtcctccgcgccggcggggctgctgctgctgctgttgcgggcggcggcatcccgtcgacggagtggcagctaccaccggcggaggaggaggaggaagagccgggtctcttcccgctgccgccgtcgtcgtcggatggctccggcatgagcggcgcggatgcgttcggcgacccgttcgctggcctccccgaccccttcggtggcgactacccctcctctggcggagcggcggcggccgccgacttctttgacgccgtcgtggccaaggccgggttcgtcgacgtcggtgtcctcggtggcggcggcggcggtggctgcgatggaggtggcgttgatggtggtggaggagggtcgtcgctgctgggcatgagcaagcctatcttgcctagggccgccatgcagttgccgtcggtgtcgccgagggcgatacggccgtaccccgtgatggccggtgacacggtgaagctcggcgcgccgatggccggcgggccgtgcgcgttcgacggcgccgccgcggcagggctgcacatgtcgtcgtcgccgcgtggcgccgtcggcgggatcaagcgcaggttcgccgcaccgatatatgatcgctcgctagctatagctcgctgtttcgctcagatctacgcaaactaataattcttgacgagcgccatgaaaccgagtcctttgatttcttgctgtgctggaggaacagttaaaaagattcccaatttagggaaagtttgcgcttccttttcttgctgcccagcctgcatgccctacaatttccccatcttgcacctcccaacaaggcagtaaggatcaagataaaggaaagaaattgtgagccagtttttgatctgttcagacaaaaacagcaaaaatcaaggtttcatacattcaggaatcatctagctgatgaaatgaatgttgcgacttcgtcaaagccagcaaaagtggtatatacacagataggaacatatatattatagcatcgcatagaaggctaatttagtagctcttcaaatcaatttgttcttcaaaccctaagtttcagtttccacatcatgttcagagaaggctatatatccgtacatctgttgaaaacgagtaattaagctagaaagtgttgatctgatgattgagtagtcgagtactttactgtgcatgcatatgggttgcttgatgtggtggattttgcatctgttgatgcaggaagaaccaggctaggaaggtggtgtgcatcccagcgcctgcagcagcaggagggaggaccagtggggaggttgttccttccgatctctgggcttggaggaagtatggccagaagcctatcaaaggctctccttacccaaggtatgatgtgactgcatctgaactattctctcacactaatctctgcctttcacttgcataatatacaatggctaccatctctcttcttctgctactctaatccttgtatacatctggatatctgtgtgctgtcataattgtggtgatcatcatctaatctcataacacatgctcaaactccaatagattcctcaccccaaccaggagaggggaagacacatggattcctgtcttttctattgttagtgtactatagttgttgatagaagcacatgatacaatataaactgcaatgggcacaagtggaggaagtaatagaactaatttcagttttcccctttttttctgagcttggtagtacattaattactttgtcctttcaactggactgtggaattttcatatatagttgcgtatatccttgatatgtagatgctggatggtgtaaaaaaaaattggttatctcaagaaactaaggaattttctcctacttacaaaaaatatgtagagtacatacgtctaatcatgatccctctcacatactttcaatctcctaacagaaatgtatactcaattcaactttaatttgatgcataaagagatatgatgagctaccttttttaaaagggactatgatgagctattataataaaccaaaagaaatttagtatataatatggagttgccttgctatccacaatgccagtttagaagttttgtttttttagaattattatgtgataagttttctaccaaaaacaagttctctttctcattaatcaggaagaagttaaagcgcacatattggaatatactgtttccaacttgcaaattaactagttatctccccattgttgagtaagaaatccatgtagtgatatatgtggattgtgtttaagttagacttaattaataaaaacctttttttgcaccaatcttttttattaagaaattatatttaatgtatttatatatgtgcatgttttcatactctttgtattagtctatgtagtttgttctttcgcaaacagatatatgtgatcaaagttaggttcttttttacttccatataaaattataaaagttaatgtcaggtgctacttacctagttttggttattgtatattatatttgtacgagatcaattactttgattgattccctgtggtcaaaacttgatctttattgagtgtgatttaattttgtttgttattttaattttagtattaaagttatagtaacattatttttaaaacgtcaaataagcatcattattgtgacaatattgaatttaatatagtaactatactttatttttgtattggtttcaaaatatgatttccatatatatgagcaacctaaatacttaacatggttttatatggtttgctgaagataatgaataaaaaatcacatgcacaccagatttatattactcctattttttgtttcacacaaagaagcatgcaactgtcctaatttacattaaatgaaaaatcatgatgattacatatgttaacatgttttcactggaaactagtaaatgtgtgatgatcagtcctagaggtgaatgaaacacaatatgcagatgtagtatatgcatatcatgactttatttatttcgattgattgcccgccaagatatatatataaaatttaaggtttattattattatatacttactttgttctaaaatataagcaactctggttatgcacatgaaaatacgttcagttgcataggcagaaatgcttatattttggaaggttatatagaggagtacctgttttaacatgaatagatgcagtttcctcctaaatatatgtagctacacgttggcgtaccacatcctgaaatttgattgtgtgcaaatgttcatttcttcagagggtactacagatgcagcagctcgaaaggatgctcggcgcgcaagcaggtggagcgcagccggaccgaccccaacatgctcgtcatcacctacacgtcggagcacaaccacccgtggccgacgcagcgcaacgcgctcgccggctccacgcggtctcatcacgccaagaacagcagcagcaacagcagcagcagcggcgcctcctcagcctccaagaacaactcctcccacagcggttaccaccaccaccaccaccagaagccactcgtcaaggcggaacccaacgatcaatccgccgccgccacgaccgccgccacggtgccggtgaaagaggaggccgccatggtagggacgtcgtcggaagcattggcgaagacgacgcagaaatccatggaggatgctgctgctgctgcttcagccacggcggcggcggtggagcacagtgatctcatgcagcagatgttcagccagagctaccggccgatgataccggaggcagcggccggcggccaccacgacgacttcttcgccgacctcgccgagttggagtcagatcccatgagcctgatcttctccaaggagtacatggcgaccaattacaagccagcaggtgacccagcaggcaaggagatgaatgcagtagacaagggcttggatccagcgtacatgctggattggtcttctaccactgttgttactagagctggtgggagctcatttatgcaaggggagggaggtttatgacattttaatcactttgaaacaaaaggcaaaagctagtatatgcgaatgcaaaca</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0698800, RefSeq:Os02g0698800