Difference between revisions of "Os02g0698800"
(→Evolution) |
(→Function) |
||
| Line 4: | Line 4: | ||
===Function=== | ===Function=== | ||
WRKY transcription factors (TFs) are key regulators of many plant processes, including the responses to biotic and abiotic stresses, senescence, seed dormancy and seed germination. For over 15 years, limited evidence has been available suggesting that WRKY TFs may play roles in regulating plant responses to the phytohormone abscisic acid (ABA), notably some WRKY TFs are ABA-inducible repressors of seed germination. However, the roles of WRKY TFs in other aspects of ABA signalling, and the mechanisms involved, have remained unclear. Recent significant progress in ABA research has now placed specific WRKY TFs firmly in ABA-responsive signalling pathways, where they act at multiple levels. In Arabidopsis, WRKY TFs appear to act downstream of at least two ABA receptors: the cytoplasmic PYR/PYL/RCAR-protein phosphatase 2C-ABA complex and the chloroplast envelope-located ABAR-ABA complex. In vivo and in vitro promoter-binding studies show that the target genes for WRKY TFs that are involved in ABA signalling include well-known ABA-responsive genes such as ABF2, ABF4, ABI4, ABI5, MYB2, DREB1a, DREB2a and RAB18. Additional well-characterized stress-inducible genes such as RD29A and COR47 are also found in signalling pathways downstream of WRKY TFs. These new insights also reveal that some WRKY TFs are positive regulators of ABA-mediated stomatal closure and hence drought responses. Conversely, many WRKY TFs are negative regulators of seed germination, and controlling seed germination appears a common function of a subset of WRKY TFs in flowering plants. Taken together, these new data demonstrate that WRKY TFs are key nodes in ABA-responsive signalling networks. | WRKY transcription factors (TFs) are key regulators of many plant processes, including the responses to biotic and abiotic stresses, senescence, seed dormancy and seed germination. For over 15 years, limited evidence has been available suggesting that WRKY TFs may play roles in regulating plant responses to the phytohormone abscisic acid (ABA), notably some WRKY TFs are ABA-inducible repressors of seed germination. However, the roles of WRKY TFs in other aspects of ABA signalling, and the mechanisms involved, have remained unclear. Recent significant progress in ABA research has now placed specific WRKY TFs firmly in ABA-responsive signalling pathways, where they act at multiple levels. In Arabidopsis, WRKY TFs appear to act downstream of at least two ABA receptors: the cytoplasmic PYR/PYL/RCAR-protein phosphatase 2C-ABA complex and the chloroplast envelope-located ABAR-ABA complex. In vivo and in vitro promoter-binding studies show that the target genes for WRKY TFs that are involved in ABA signalling include well-known ABA-responsive genes such as ABF2, ABF4, ABI4, ABI5, MYB2, DREB1a, DREB2a and RAB18. Additional well-characterized stress-inducible genes such as RD29A and COR47 are also found in signalling pathways downstream of WRKY TFs. These new insights also reveal that some WRKY TFs are positive regulators of ABA-mediated stomatal closure and hence drought responses. Conversely, many WRKY TFs are negative regulators of seed germination, and controlling seed germination appears a common function of a subset of WRKY TFs in flowering plants. Taken together, these new data demonstrate that WRKY TFs are key nodes in ABA-responsive signalling networks. | ||
| + | The plants during their sessile, autotrophic lifestyle are affected by wide range of environmental signals and regulate complex patterns of gene expression with the help of transcription factors. The WRKY transcription factors are considered as plant-specific, however, are also reported in protist, slime mold, fern and pine. The WRKY name is coined from its highly conserved 60 amino acid long WRKY domain. These TFs show W box specific binding which is also influenced by the W box flanking sequence. During evolution, the family has expanded in different patterns to facilitate distinct cellular, developmental, and physiological role in plants. The WRKY TFs form one of the largest families in flowering plants, and play a broad spectrum regulatory role as positive and negative regulators of plant defense regulation, abiotic stresses and also involved in growth and development of plants. | ||
===Expression=== | ===Expression=== | ||
Revision as of 08:30, 30 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
WRKY transcription factors (TFs) are key regulators of many plant processes, including the responses to biotic and abiotic stresses, senescence, seed dormancy and seed germination. For over 15 years, limited evidence has been available suggesting that WRKY TFs may play roles in regulating plant responses to the phytohormone abscisic acid (ABA), notably some WRKY TFs are ABA-inducible repressors of seed germination. However, the roles of WRKY TFs in other aspects of ABA signalling, and the mechanisms involved, have remained unclear. Recent significant progress in ABA research has now placed specific WRKY TFs firmly in ABA-responsive signalling pathways, where they act at multiple levels. In Arabidopsis, WRKY TFs appear to act downstream of at least two ABA receptors: the cytoplasmic PYR/PYL/RCAR-protein phosphatase 2C-ABA complex and the chloroplast envelope-located ABAR-ABA complex. In vivo and in vitro promoter-binding studies show that the target genes for WRKY TFs that are involved in ABA signalling include well-known ABA-responsive genes such as ABF2, ABF4, ABI4, ABI5, MYB2, DREB1a, DREB2a and RAB18. Additional well-characterized stress-inducible genes such as RD29A and COR47 are also found in signalling pathways downstream of WRKY TFs. These new insights also reveal that some WRKY TFs are positive regulators of ABA-mediated stomatal closure and hence drought responses. Conversely, many WRKY TFs are negative regulators of seed germination, and controlling seed germination appears a common function of a subset of WRKY TFs in flowering plants. Taken together, these new data demonstrate that WRKY TFs are key nodes in ABA-responsive signalling networks. The plants during their sessile, autotrophic lifestyle are affected by wide range of environmental signals and regulate complex patterns of gene expression with the help of transcription factors. The WRKY transcription factors are considered as plant-specific, however, are also reported in protist, slime mold, fern and pine. The WRKY name is coined from its highly conserved 60 amino acid long WRKY domain. These TFs show W box specific binding which is also influenced by the W box flanking sequence. During evolution, the family has expanded in different patterns to facilitate distinct cellular, developmental, and physiological role in plants. The WRKY TFs form one of the largest families in flowering plants, and play a broad spectrum regulatory role as positive and negative regulators of plant defense regulation, abiotic stresses and also involved in growth and development of plants.
Expression
WRKY proteins comprise a large family of transcription factors. Despite their dramatic diversification in plants, WRKY genes seem to have originated in early eukaryotes. The cognate DNA-binding site of WRKY factors is well defined, but determining the roles of individual family members in regulating specific transcriptional programs during development or in response to environmental signals remains daunting. This review summarises the recent advances made in starting to unravel the various functions controlled by WRKY proteins.
Evolution
New findings illustrate that WRKY proteins often act as repressors as well as activators, and that members of the family play roles in both the repression and de-repression of important plant processes. Furthermore, it is becoming clear that a single WRKY transcription factor might be involved in regulating several seemingly disparate processes. Mechanisms of signalling and transcriptional regulation are being dissected, uncovering WRKY protein functions via interactions with a diverse array of protein partners, including MAP kinases, MAP kinase kinases, 14-3-3 proteins, calmodulin, histone deacetylases, resistance proteins and other WRKY transcription factors. WRKY genes exhibit extensive autoregulation and cross-regulation that facilitates transcriptional reprogramming in a dynamic web with built-in redundancy. reat progress has been made since then in establishing the diverse biological roles of WRKY transcription factors in plant growth, development, and responses to biotic and abiotic stress. Despite the functional diversity, almost all analyzed WRKY proteins recognize the TTGACC/T W-box sequences and, therefore, mechanisms other than mere recognition of the core W-box promoter elements are necessary to achieve the regulatory specificity of WRKY transcription factors. Research over the past several years has revealed that WRKY transcription factors physically interact with a wide range of proteins with roles in signaling, transcription, and chromatin remodeling. Studies of WRKY-interacting proteins have provided important insights into the regulation and mode of action of members of the important family of transcription factors. It has also emerged that the slightly varied WRKY domains and other protein motifs conserved within each of the seven WRKY subfamilies participate in protein-protein interactions and mediate complex functional interactions between WRKY proteins and between WRKY and other regulatory proteins in the modulation of important biological processes. In this review, we summarize studies of protein-protein interactions for WRKY transcription factors and discuss how the interacting partners contribute, at different levels, to the establishment of the complex regulatory and functional network of WRKY transcription factors.
Labs working on this gene
Department of Biology and Microbiology, South Dakota State University, Brookings, SD, USA. Key Laboratory of Tropical Forest Ecology, Xishuangbanna Tropical Botanical Garden, Chinese Academy of Sciences, Yunnan, China. Department of Biology and Microbiology, South Dakota State University, Brookings, SD 57007, USA. Max-Plank-Institute for Plant Breeding Research, Department of Plant-Microbe Interactions, Carl-von-Linné Weg 10, D-50829 Köln, Germany.
References
Please input cited references here.
Structured Information
| Gene Name |
Os02g0698800 |
|---|---|
| Description |
WRKY transcription factor 66 |
| Version |
NM_001054362.1 GI:115448094 GeneID:4330420 |
| Length |
4149 bp |
| Definition |
Oryza sativa Japonica Group Os02g0698800, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:29613644..29617792 |
| Sequence Coding Region |
29613699..29614333,29614965..29615105,29616994..29617738 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:29613644..29617792 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:29613644..29617792 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtgtgattacttcttgcaacggatggagggggagcaggccgccggagacctcgccgacatcgtcctccgcgccggcggggctgctgctgctgctgttgcgggcggcggcatcccgtcgacggagtggcagctaccaccggcggaggaggaggaggaagagccgggtctcttcccgctgccgccgtcgtcgtcggatggctccggcatgagcggcgcggatgcgttcggcgacccgttcgctggcctccccgaccccttcggtggcgactacccctcctctggcggagcggcggcggccgccgacttctttgacgccgtcgtggccaaggccgggttcgtcgacgtcggtgtcctcggtggcggcggcggcggtggctgcgatggaggtggcgttgatggtggtggaggagggtcgtcgctgctgggcatgagcaagcctatcttgcctagggccgccatgcagttgccgtcggtgtcgccgagggcgatacggccgtaccccgtgatggccggtgacacggtgaagctcggcgcgccgatggccggcgggccgtgcgcgttcgacggcgccgccgcggcagggctgcacatgtcgtcgtcgccgcgtggcgccgtcggcgggatcaagcgcaggaagaaccaggctaggaaggtggtgtgcatcccagcgcctgcagcagcaggagggaggaccagtggggaggttgttccttccgatctctgggcttggaggaagtatggccagaagcctatcaaaggctctccttacccaagagggtactacagatgcagcagctcgaaaggatgctcggcgcgcaagcaggtggagcgcagccggaccgaccccaacatgctcgtcatcacctacacgtcggagcacaaccacccgtggccgacgcagcgcaacgcgctcgccggctccacgcggtctcatcacgccaagaacagcagcagcaacagcagcagcagcggcgcctcctcagcctccaagaacaactcctcccacagcggttaccaccaccaccaccaccagaagccactcgtcaaggcggaacccaacgatcaatccgccgccgccacgaccgccgccacggtgccggtgaaagaggaggccgccatggtagggacgtcgtcggaagcattggcgaagacgacgcagaaatccatggaggatgctgctgctgctgcttcagccacggcggcggcggtggagcacagtgatctcatgcagcagatgttcagccagagctaccggccgatgataccggaggcagcggccggcggccaccacgacgacttcttcgccgacctcgccgagttggagtcagatcccatgagcctgatcttctccaaggagtacatggcgaccaattacaagccagcaggtgacccagcaggcaaggagatgaatgcagtagacaagggcttggatccagcgtacatgctggattggtcttctaccactgttgttactagagctggtgggagctcatttatgcaaggggagggaggtttatga</cdnaseq> |
| Protein Sequence |
<aaseq>MCDYFLQRMEGEQAAGDLADIVLRAGGAAAAAVAGGGIPSTEWQ LPPAEEEEEEPGLFPLPPSSSDGSGMSGADAFGDPFAGLPDPFGGDYPSSGGAAAAAD FFDAVVAKAGFVDVGVLGGGGGGGCDGGGVDGGGGGSSLLGMSKPILPRAAMQLPSVS PRAIRPYPVMAGDTVKLGAPMAGGPCAFDGAAAAGLHMSSSPRGAVGGIKRRKNQARK VVCIPAPAAAGGRTSGEVVPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCSARKQV ERSRTDPNMLVITYTSEHNHPWPTQRNALAGSTRSHHAKNSSSNSSSSGASSASKNNS SHSGYHHHHHQKPLVKAEPNDQSAAATTAATVPVKEEAAMVGTSSEALAKTTQKSMED AAAAASATAAAVEHSDLMQQMFSQSYRPMIPEAAAGGHHDDFFADLAELESDPMSLIF SKEYMATNYKPAGDPAGKEMNAVDKGLDPAYMLDWSSTTVVTRAGGSSFMQGEGGL</aaseq> |
| Gene Sequence |
<dnaseqindica>56..690#1322..1462#3351..4095#gcgagcgtcagagagagagagagagagaggaggtggtggtggtggtcagatcatcatgtgtgattacttcttgcaacggatggagggggagcaggccgccggagacctcgccgacatcgtcctccgcgccggcggggctgctgctgctgctgttgcgggcggcggcatcccgtcgacggagtggcagctaccaccggcggaggaggaggaggaagagccgggtctcttcccgctgccgccgtcgtcgtcggatggctccggcatgagcggcgcggatgcgttcggcgacccgttcgctggcctccccgaccccttcggtggcgactacccctcctctggcggagcggcggcggccgccgacttctttgacgccgtcgtggccaaggccgggttcgtcgacgtcggtgtcctcggtggcggcggcggcggtggctgcgatggaggtggcgttgatggtggtggaggagggtcgtcgctgctgggcatgagcaagcctatcttgcctagggccgccatgcagttgccgtcggtgtcgccgagggcgatacggccgtaccccgtgatggccggtgacacggtgaagctcggcgcgccgatggccggcgggccgtgcgcgttcgacggcgccgccgcggcagggctgcacatgtcgtcgtcgccgcgtggcgccgtcggcgggatcaagcgcaggttcgccgcaccgatatatgatcgctcgctagctatagctcgctgtttcgctcagatctacgcaaactaataattcttgacgagcgccatgaaaccgagtcctttgatttcttgctgtgctggaggaacagttaaaaagattcccaatttagggaaagtttgcgcttccttttcttgctgcccagcctgcatgccctacaatttccccatcttgcacctcccaacaaggcagtaaggatcaagataaaggaaagaaattgtgagccagtttttgatctgttcagacaaaaacagcaaaaatcaaggtttcatacattcaggaatcatctagctgatgaaatgaatgttgcgacttcgtcaaagccagcaaaagtggtatatacacagataggaacatatatattatagcatcgcatagaaggctaatttagtagctcttcaaatcaatttgttcttcaaaccctaagtttcagtttccacatcatgttcagagaaggctatatatccgtacatctgttgaaaacgagtaattaagctagaaagtgttgatctgatgattgagtagtcgagtactttactgtgcatgcatatgggttgcttgatgtggtggattttgcatctgttgatgcaggaagaaccaggctaggaaggtggtgtgcatcccagcgcctgcagcagcaggagggaggaccagtggggaggttgttccttccgatctctgggcttggaggaagtatggccagaagcctatcaaaggctctccttacccaaggtatgatgtgactgcatctgaactattctctcacactaatctctgcctttcacttgcataatatacaatggctaccatctctcttcttctgctactctaatccttgtatacatctggatatctgtgtgctgtcataattgtggtgatcatcatctaatctcataacacatgctcaaactccaatagattcctcaccccaaccaggagaggggaagacacatggattcctgtcttttctattgttagtgtactatagttgttgatagaagcacatgatacaatataaactgcaatgggcacaagtggaggaagtaatagaactaatttcagttttcccctttttttctgagcttggtagtacattaattactttgtcctttcaactggactgtggaattttcatatatagttgcgtatatccttgatatgtagatgctggatggtgtaaaaaaaaattggttatctcaagaaactaaggaattttctcctacttacaaaaaatatgtagagtacatacgtctaatcatgatccctctcacatactttcaatctcctaacagaaatgtatactcaattcaactttaatttgatgcataaagagatatgatgagctaccttttttaaaagggactatgatgagctattataataaaccaaaagaaatttagtatataatatggagttgccttgctatccacaatgccagtttagaagttttgtttttttagaattattatgtgataagttttctaccaaaaacaagttctctttctcattaatcaggaagaagttaaagcgcacatattggaatatactgtttccaacttgcaaattaactagttatctccccattgttgagtaagaaatccatgtagtgatatatgtggattgtgtttaagttagacttaattaataaaaacctttttttgcaccaatcttttttattaagaaattatatttaatgtatttatatatgtgcatgttttcatactctttgtattagtctatgtagtttgttctttcgcaaacagatatatgtgatcaaagttaggttcttttttacttccatataaaattataaaagttaatgtcaggtgctacttacctagttttggttattgtatattatatttgtacgagatcaattactttgattgattccctgtggtcaaaacttgatctttattgagtgtgatttaattttgtttgttattttaattttagtattaaagttatagtaacattatttttaaaacgtcaaataagcatcattattgtgacaatattgaatttaatatagtaactatactttatttttgtattggtttcaaaatatgatttccatatatatgagcaacctaaatacttaacatggttttatatggtttgctgaagataatgaataaaaaatcacatgcacaccagatttatattactcctattttttgtttcacacaaagaagcatgcaactgtcctaatttacattaaatgaaaaatcatgatgattacatatgttaacatgttttcactggaaactagtaaatgtgtgatgatcagtcctagaggtgaatgaaacacaatatgcagatgtagtatatgcatatcatgactttatttatttcgattgattgcccgccaagatatatatataaaatttaaggtttattattattatatacttactttgttctaaaatataagcaactctggttatgcacatgaaaatacgttcagttgcataggcagaaatgcttatattttggaaggttatatagaggagtacctgttttaacatgaatagatgcagtttcctcctaaatatatgtagctacacgttggcgtaccacatcctgaaatttgattgtgtgcaaatgttcatttcttcagagggtactacagatgcagcagctcgaaaggatgctcggcgcgcaagcaggtggagcgcagccggaccgaccccaacatgctcgtcatcacctacacgtcggagcacaaccacccgtggccgacgcagcgcaacgcgctcgccggctccacgcggtctcatcacgccaagaacagcagcagcaacagcagcagcagcggcgcctcctcagcctccaagaacaactcctcccacagcggttaccaccaccaccaccaccagaagccactcgtcaaggcggaacccaacgatcaatccgccgccgccacgaccgccgccacggtgccggtgaaagaggaggccgccatggtagggacgtcgtcggaagcattggcgaagacgacgcagaaatccatggaggatgctgctgctgctgcttcagccacggcggcggcggtggagcacagtgatctcatgcagcagatgttcagccagagctaccggccgatgataccggaggcagcggccggcggccaccacgacgacttcttcgccgacctcgccgagttggagtcagatcccatgagcctgatcttctccaaggagtacatggcgaccaattacaagccagcaggtgacccagcaggcaaggagatgaatgcagtagacaagggcttggatccagcgtacatgctggattggtcttctaccactgttgttactagagctggtgggagctcatttatgcaaggggagggaggtttatgacattttaatcactttgaaacaaaaggcaaaagctagtatatgcgaatgcaaaca</dnaseqindica> |
| External Link(s) |