Difference between revisions of "Os11g0210300"
| Line 1: | Line 1: | ||
| − | Adh1 gene locus, elongating coleoptile when rice in flooded conditions. | + | ''Adh1'' gene locus, elongating coleoptile when rice in flooded conditions. |
==Annotated Information== | ==Annotated Information== | ||
| Line 6: | Line 6: | ||
In many higher plants, alcoholic fermentation is necessary for germination and survival under anaerobic conditions caused by heavy rain and flooding <ref name="ref1" />. Alcoholic fermentation occurs in two reaction steps: the decarboxylation of pyruvate to acetaldehyde by pyruvate decarboxylase (PDC) and the subsequent reduction of acetaldehyde to ethanol by lcohol dehydrogenase (ADH). This metabolic pathway supports glycolysis and ATP synthesis by recycling NAD+. Analyses of ADH deficient mutants in maize <ref name="ref2" /><ref name="ref3" /><ref name="ref4" />, barley <ref name="ref5" />, Arabidopsis <ref name="ref6" /><ref name="ref7" /> and rice <ref name="ref8" /> have shown that ADH is required for anaerobic tolerance in plants. | In many higher plants, alcoholic fermentation is necessary for germination and survival under anaerobic conditions caused by heavy rain and flooding <ref name="ref1" />. Alcoholic fermentation occurs in two reaction steps: the decarboxylation of pyruvate to acetaldehyde by pyruvate decarboxylase (PDC) and the subsequent reduction of acetaldehyde to ethanol by lcohol dehydrogenase (ADH). This metabolic pathway supports glycolysis and ATP synthesis by recycling NAD+. Analyses of ADH deficient mutants in maize <ref name="ref2" /><ref name="ref3" /><ref name="ref4" />, barley <ref name="ref5" />, Arabidopsis <ref name="ref6" /><ref name="ref7" /> and rice <ref name="ref8" /> have shown that ADH is required for anaerobic tolerance in plants. | ||
| − | When rice germinates under water, ADH activity is required for coleoptile elongation <ref name="ref9" /><ref name="ref10" /> <ref name="ref11" />. Matsumura et al. <ref name="ref12" /> isolated a single recessive rice mutant, whose ADH activity was markedly reduced. Thus, the mutant was designated as reduced adh activity (rad) mutant. Elongation of the coleoptile was strongly repressed in the submerged rad mutant <ref name="ref12" />. Subsequently, the amount of ADHl protein, but not the amount of ADH2 protein, in shoots and roots in the rad mutant was found to be lower than that in the wild type, while the Adhl mRNA levels in the rad mutant were comparable to those in the wild type <ref name="ref8" />. | + | When rice germinates under water, ADH activity is required for coleoptile elongation <ref name="ref9" /><ref name="ref10" /> <ref name="ref11" />. Matsumura et al. <ref name="ref12" /> isolated a single recessive rice mutant, whose ADH activity was markedly reduced. Thus, the mutant was designated as reduced ''adh'' activity (rad) mutant. Elongation of the coleoptile was strongly repressed in the submerged rad mutant <ref name="ref12" />. Subsequently, the amount of ADHl protein, but not the amount of ADH2 protein, in shoots and roots in the rad mutant was found to be lower than that in the wild type, while the Adhl mRNA levels in the rad mutant were comparable to those in the wild type <ref name="ref8" />. |
| − | The rad Adhl gene displayed a point mutation linked to the phenotype ofrepressed coleoptile elongation. | + | The rad ''Adhl'' gene displayed a point mutation linked to the phenotype ofrepressed coleoptile elongation. |
===Mutant=== | ===Mutant=== | ||
| Line 15: | Line 15: | ||
[[File:Shijc-Fig2.jpg|right|thumb|300px|''Comparison of coleoptiles of wild type rice and the rad mutant. (from reference <ref name="ref13" />).'']] | [[File:Shijc-Fig2.jpg|right|thumb|300px|''Comparison of coleoptiles of wild type rice and the rad mutant. (from reference <ref name="ref13" />).'']] | ||
| − | Under submerged conditions, the coleoptiles of the wild type Kinmaze began to elongate one day after imbibition and reached an average length of 52.2 mm after 5 days. However, the coleoptiles ofthe rad mutant hardly elongated even after 5 days. This result was consistent with the findings of <ref name="ref12" />. The relative transcript levels of | + | Under submerged conditions, the coleoptiles of the wild type Kinmaze began to elongate one day after imbibition and reached an average length of 52.2 mm after 5 days. However, the coleoptiles ofthe rad mutant hardly elongated even after 5 days. This result was consistent with the findings of <ref name="ref12" />. The relative transcript levels of ''Adh1'' in the coleoptile were comparable between the rad mutant and Kinmaze, while the amount of ADH protein in the coleoptiles in the radmutant was 5-fold lower than that in Kinmaze. These results were similar to those observed in the leaves and roots ofthe rad mutant <ref name="ref8" />. On the other hand, the Pdc1 mRNA levels and the PDC protein levels were comparable between the rad mutant and Kinmaze, suggesting that the expression of the Pdc1 gene was not affected by the reduction ofthe ADH protein level. |
===Alternative Splicing=== | ===Alternative Splicing=== | ||
| Line 48: | Line 48: | ||
<ref name="ref1">Tadege,M., I.Dupuis and C.Kuhlemeier (1999) Ethanolic fermentation: new functions for an old pathway. Trends Plant Sci. 4: 320-325.</ref> | <ref name="ref1">Tadege,M., I.Dupuis and C.Kuhlemeier (1999) Ethanolic fermentation: new functions for an old pathway. Trends Plant Sci. 4: 320-325.</ref> | ||
<ref name="ref2">Schwartz,D. (1969) An example of gene fixation resulting from selective advantage in suboptimal conditions. Am. Nat. 103: 479-481.</ref> | <ref name="ref2">Schwartz,D. (1969) An example of gene fixation resulting from selective advantage in suboptimal conditions. Am. Nat. 103: 479-481.</ref> | ||
| − | <ref name="ref3">Freeling,M. and D.C.Bennett (1985) Maize | + | <ref name="ref3">Freeling,M. and D.C.Bennett (1985) Maize Adh1. Ann. Rev. Genet.19: 297-323.</ref> |
| − | <ref name="ref4">Johnson,J.R., B.G.Cobb and M.C.Drew (1994) Hypoxic induction of anoxia tolerance in roots of | + | <ref name="ref4">Johnson,J.R., B.G.Cobb and M.C.Drew (1994) Hypoxic induction of anoxia tolerance in roots of Adh1 null Zea mays L. Plant Physiol. 105: 61-67.</ref> |
<ref name="ref5">Harberd,N.P. and K.J.R. Edwards (1982) The effect of a mutation causing alcohol dehydrogenase deficiency on flooding tolerance in barley. New Phytol. 90: 631-644.</ref> | <ref name="ref5">Harberd,N.P. and K.J.R. Edwards (1982) The effect of a mutation causing alcohol dehydrogenase deficiency on flooding tolerance in barley. New Phytol. 90: 631-644.</ref> | ||
<ref name="ref6">Jacobs,M., R.Dolferus and D.VandenBossche (1988) Isolation and biochemical analysis of ethyl methanesulfonate-induced alcohol dehydrogenase null mutants of Arabidopsis thaliana (L.) Heynh. Biochem. Genet. 26: 105-122.</ref> | <ref name="ref6">Jacobs,M., R.Dolferus and D.VandenBossche (1988) Isolation and biochemical analysis of ethyl methanesulfonate-induced alcohol dehydrogenase null mutants of Arabidopsis thaliana (L.) Heynh. Biochem. Genet. 26: 105-122.</ref> | ||
| Line 59: | Line 59: | ||
<ref name="ref11">Kato-Noguchi,H. and T.Kugimiya (2003) Preferential induction of alcohol dehydrogenase in coleoptiles of rice seedlings germinated in submergence condition. Biol. Plant. 46: 153-155.</ref> | <ref name="ref11">Kato-Noguchi,H. and T.Kugimiya (2003) Preferential induction of alcohol dehydrogenase in coleoptiles of rice seedlings germinated in submergence condition. Biol. Plant. 46: 153-155.</ref> | ||
<ref name="ref12">Matsumura,H., T.Takano, K.T.Yoshida and G.Takeda (1995) A rice mutant lacking Alcohol-dehydrogenase. Breed. Sci. 45: 365-367.(1995)</ref> | <ref name="ref12">Matsumura,H., T.Takano, K.T.Yoshida and G.Takeda (1995) A rice mutant lacking Alcohol-dehydrogenase. Breed. Sci. 45: 365-367.(1995)</ref> | ||
| − | <ref name="ref13">Hiroaki,S., H. Matsumura, T. Takano, N. Tsutsumi and M. Nakazono (2006) A Point Mutation | + | <ref name="ref13">Hiroaki,S., H. Matsumura, T. Takano, N. Tsutsumi and M. Nakazono (2006) A Point Mutation ofAdh1 Gene is Involved in the Repression of Coleoptile Elongation under Submergence in Rice. Breed. Sci. 56: 69-74</ref> |
==Structured Information== | ==Structured Information== | ||
Revision as of 15:58, 30 May 2014
Adh1 gene locus, elongating coleoptile when rice in flooded conditions.
Contents
Annotated Information
Function
In many higher plants, alcoholic fermentation is necessary for germination and survival under anaerobic conditions caused by heavy rain and flooding [2]. Alcoholic fermentation occurs in two reaction steps: the decarboxylation of pyruvate to acetaldehyde by pyruvate decarboxylase (PDC) and the subsequent reduction of acetaldehyde to ethanol by lcohol dehydrogenase (ADH). This metabolic pathway supports glycolysis and ATP synthesis by recycling NAD+. Analyses of ADH deficient mutants in maize [3][4][5], barley [6], Arabidopsis [7][8] and rice [9] have shown that ADH is required for anaerobic tolerance in plants. When rice germinates under water, ADH activity is required for coleoptile elongation [10][11] [12]. Matsumura et al. [13] isolated a single recessive rice mutant, whose ADH activity was markedly reduced. Thus, the mutant was designated as reduced adh activity (rad) mutant. Elongation of the coleoptile was strongly repressed in the submerged rad mutant [13]. Subsequently, the amount of ADHl protein, but not the amount of ADH2 protein, in shoots and roots in the rad mutant was found to be lower than that in the wild type, while the Adhl mRNA levels in the rad mutant were comparable to those in the wild type [9]. The rad Adhl gene displayed a point mutation linked to the phenotype ofrepressed coleoptile elongation.
Mutant
The DNA sequence of Kinmaze is identical to rad mutant except for a G to A transition at position 106 at CDS region that resulted in a change of the predicted amino acid Glutamate (Glu-36) in Kinmaze to Lys in rad mutant. [1]
Expression
Under submerged conditions, the coleoptiles of the wild type Kinmaze began to elongate one day after imbibition and reached an average length of 52.2 mm after 5 days. However, the coleoptiles ofthe rad mutant hardly elongated even after 5 days. This result was consistent with the findings of [13]. The relative transcript levels of Adh1 in the coleoptile were comparable between the rad mutant and Kinmaze, while the amount of ADH protein in the coleoptiles in the radmutant was 5-fold lower than that in Kinmaze. These results were similar to those observed in the leaves and roots ofthe rad mutant [9]. On the other hand, the Pdc1 mRNA levels and the PDC protein levels were comparable between the rad mutant and Kinmaze?, suggesting that the expression of the Pdc1 gene was not affected by the reduction ofthe ADH protein level.
Alternative Splicing
| Loci ID | CDS Coordinates | Length of nucleotides | Predicted length of protein |
|---|---|---|---|
| LOC_Os11g10480.1 | 5713026 ~ 5715916 | 1140 | 380 |
| LOC_Os11g10480.2 | 5713026 ~ 5715555 | 1038 | 346 |
| LOC_Os11g10480.4 | 5713026 ~ 5714398 | 807 | 269 |
Labs working on this gene
Laboratory of Plant Molecular Genetics, Graduate School of Agricultural and Life Sciences, The University of Tokyo, 1-1-1 Yayoi, Bunkyo, Tokyo 113-8657, Japan
References
<references> [2] [3] [4] [5] [6] [7] [8] [9] [10] [11] [12] [13] [1]
Structured Information
| Gene Name |
Os11g0210300 |
|---|---|
| Description |
Alcohol dehydrogenase 1 |
| Version |
NM_001074016.1 GI:115484680 GeneID:4350053 |
| Length |
3618 bp |
| Definition |
Oryza sativa Japonica Group Os11g0210300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 11:5695598..5699215 |
| Sequence Coding Region |
5695953..5696069,5696229..5696390,5696473..5696568,5696649..5696710,5696792..5696867 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008404:5695598..5699215 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008404:5695598..5699215 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgaccgcagggaaggtgatcaagtgcaaagcggcggtggcatgggaggccgcgaagccgctggtgatcgaggaggtggaggtggcgccgccgcaggccatggaggtgcgcgtcaagatcctcttcacctcgctctgccacaccgacgtctacttctgggaggccaagggacagactcccgtgttccctcggatcttcggccatgaagctggaggtattgtggagagtgttggagagggtgtgactgatcttgcccctggtgaccatgttctccctgtgttcactggggagtgcaaggagtgtgcccactgcaagtcagcagagagcaacatgtgtgatctgctcaggatcaacactgacaggggtgtgatgattggtgatggcaaatcacgcttttccatcaacgggaagcccatttaccatttcgtcgggacttcgaccttcagcgagtacactgtcatgcatgttggttgcgttgcgaagatcaacccggcagctccacttgataaagtttgcgttcttagctgtggtatttctactggtcttggtgctacaatcaatgtggcaaagccaccaaagggttcgacggtggcgatatttggtctaggagctgtaggccttgctgccgcagaaggtgcaaggattgcaggagcgtcaaggatcattggcattgacctgaacgccaacagatttgaagaagctaggaaatttggttgcactgaatttgtgaacccaaaggaccatgacaagccagttcagcaggtacttgctgagatgaccaatggcggagttgaccgcagcgttgaatgcactggcaacatcaacgccatgatccaagcatttgaatgtgttcatgatggctggggtgttgctgttttggtcggcgtgccacacaaggacgccgagttcaagacccacccgatgaacttcctgaacgagaggactctcaagggaaccttcttcggcaactacaagccacgcaccgatctgcccaacgtcgtcgagctctacatgaagaaggagctggaggtggagaagttcatcacacacagcgtgccgttctcggagatcaacacggcgttcgacctgatgcacaagggcgagggcatccgctgcatcatccgcatggagaactga</cdnaseq> |
| Protein Sequence |
<aaseq>MATAGKVIKCKAAVAWEAAKPLVIEEVEVAPPQAMEVRVKILFT SLCHTDVYFWEAKGQTPVFPRIFGHEAGGIVESVGEGVTDLAPGDHVLPVFTGECKEC AHCKSAESNMCDLLRINTDRGVMIGDGKSRFSINGKPIYHFVGTSTFSEYTVMHVGCV AKINPAAPLDKVCVLSCGISTGLGATINVAKPPKGSTVAIFGLGAVGLAAAEGARIAG ASRIIGIDLNANRFEEARKFGCTEFVNPKDHDKPVQQVLAEMTNGGVDRSVECTGNIN AMIQAFECVHDGWGVAVLVGVPHKDAEFKTHPMNFLNERTLKGTFFGNYKPRTDLPNV VELYMKKELEVEKFITHSVPFSEINTAFDLMHKGEGIRCIIRMEN</aaseq> |
| Gene Sequence |
<dnaseqindica>3147..3263#2826..2987#2648..2743#2506..2567#2349..2424#2187..2269#1776..2101#900..946#666..802#373..406#gccggccgtcgcgcatccgacggccactcaccatcggcgtcgggggaggcgaaaacagcggctgcaattccgcttccaggtggagggggaggaggcccggtttgtgtgccacgccgccccactccgtccgtggtttgctacccaagaagacaagaagaaggaagtggcgaaacctcaccctccatcctccatcctctcctttcttccttcgaggaggaggagctatatatagacggggatggttcatctagcctcctcaccggttttgatttgatctgtgtgatttgagtgagtgagtgagattctttggaggagggattttggtttggtttggtttggtggtttgtgcgggattttgtggggaggagagtaatggcgaccgcagggaaggtgatcaagtgcaaaggtcagtgcttttcctcccctccctgtttcttcttggttcgattttgctttggattgggcgaacttttaggcattttattactggagcggcgctgtagatgaaattcttggattgtgttctttttagagttttcttgggtgaacattaccgatcttgcagaagctgtggagaaaagcatatctttttttttagtgaaaaatgtcattcaggattatgtttttttggtggattggtgggtgattttgctggatctgtgcagcggcggtggcatgggaggccgcgaagccgctggtgatcgaggaggtggaggtggcgccgccgcaggccatggaggtgcgcgtcaagatcctcttcacctcgctctgccacaccgacgtctacttctgggaggccaaggtatctactcacctcctcttcttcagttcctatccatccatagctgctccaatgtgtggttgacttgcgcctcttgtgtggcttctgaatctcttagggacagactcccgtgttccctcggatcttcggccatgaagctggagggtatgtgcttttatgcatcttcttccttgattttgtttcttgttaatacttggttgctctgatgcatgcttttgttgctgatgtgtgatgtggcatgctgttagttaattgatttgttgttactacctggttactccactgttgtggttgctagtgtggcctgttgttaattaattgattctttgttagtactacttggttactctgctgctctggttgctggtgtgttgtgttgttaattaattggctcgttgttacttcttggtttactctactgctctggttgctgatgtggcatgttgttaagtacttaaaactatgctttgtggttgaatcttcctctaattgcagtttagggggggggttcattgtttattggcttggcattagtagaacatttggctgaggtaatctggacaacatgggaaagaatcatatgggcacatgctgttgcctgtgtcaaacattataaatgtgtgctttttttgtgggtcttcagttggatcttgatagatttatcaatttataacttattacaaggaagaaactttttctttcagttagtagttggtagtttatttttgaagttggcagatttatttgtgataggcgttgattgaccctttagaagacttctcttcaataagtttgtattttccagttgacaaagggcatataaattaggcattgcttgacctttatgctacctaacatattcatggtaccctttctattttctgaaatacagcgtggattattttttttaacacttccattgagtaaaagattcctattgttcatatctgctgaaatttattcatttctgcagtattgtggagagtgttggagagggtgtgactgatcttgcccctggtgaccatgttctccctgtgttcactggggagtgcaaggagtgtgcccactgcaagtcagcagagagcaacatgtgtgatctgctcaggatcaacactgacaggggtgtgatgattggtgatggcaaatcacgcttttccatcaacgggaagcccatttaccatttcgtcgggacttcgaccttcagcgagtacactgtcatgcatgttggttgcgttgcgaagatcaacccggcagctccacttgataaagtttgcgttcttagctgtggtatttctactggtaagcagaattttttttgtttcttgcattcttcttacttgatagaatgtaagttgagatgctgagtcgcaatttccttttgtaggtcttggtgctacaatcaatgtggcaaagccaccaaagggttcgacggtggcgatatttggtctaggagctgtaggccttgctgtgagtgtctgaactcaccttgaatgttctcaattacaatgagagatccatctaattactctacatattgtctgattaggccgcagaaggtgcaaggattgcaggagcgtcaaggatcattggcattgacctgaacgccaacagatttgaagaaggtaaaatcctcttgatttaccagatcatcagtttgtttgatggtcttttaaagtcatcttatatattttgtatatcttcagctaggaaatttggttgcactgaatttgtgaacccaaaggaccatgacaagccagttcagcaggtatgtatgttcccttacatcaggaaaaggaaaatctgtatcacttgattgtactgatacagtgtgttatggtaatttaggtacttgctgagatgaccaatggcggagttgaccgcagcgttgaatgcactggcaacatcaacgccatgatccaagcatttgaatgtgttcatgatgtaagatctgaaaacagcatattgtccacttaatacagttaattcgacaagatgctaaatatattatatgttctgaatccagggctggggtgttgctgttttggtcggcgtgccacacaaggacgccgagttcaagacccacccgatgaacttcctgaacgagaggactctcaagggaaccttcttcggcaactacaagccacgcaccgatctgcccaacgtcgtcgagctctacatgaagaaggtgaatacaaatcgcgaatccttcctttcgctttatccaactattacaaactaagagtagtcgcaaaatcttcaaatgttcatcgacctcaatcaagaacttctgaaagttgggtgtgtccatgctcttatatgcatacctccgctgttgtgaattcaggagctggaggtggagaagttcatcacacacagcgtgccgttctcggagatcaacacggcgttcgacctgatgcacaagggcgagggcatccgctgcatcatccgcatggagaactgaggtttttcaggggattatggtgttgggtaataagattgggcagcttgagcagcctgccttgggtgaatgatgatatacggttcttctgtgtatcctgggcaaatttctggctttgtcaatcagtaatagtacggtatgaattccagtgtctgtagctgcaaagagtttgttaagaatcagtgatcttttggcgtaatattatcatatatttatacgagtttcagttcgtcaccctcttcacttttcagaacttttttaagtcttatgacttcagagccaccaaacgtgctgtttttgaattccatggtggcttgaatttggtacatgttcatgtaaatgtgggatatttgtcatc</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 1.2 1.3 Hiroaki,S., H. Matsumura, T. Takano, N. Tsutsumi and M. Nakazono (2006) A Point Mutation ofAdh1 Gene is Involved in the Repression of Coleoptile Elongation under Submergence in Rice. Breed. Sci. 56: 69-74
- ↑ 2.0 2.1 Tadege,M., I.Dupuis and C.Kuhlemeier (1999) Ethanolic fermentation: new functions for an old pathway. Trends Plant Sci. 4: 320-325.
- ↑ 3.0 3.1 Schwartz,D. (1969) An example of gene fixation resulting from selective advantage in suboptimal conditions. Am. Nat. 103: 479-481.
- ↑ 4.0 4.1 Freeling,M. and D.C.Bennett (1985) Maize Adh1. Ann. Rev. Genet.19: 297-323.
- ↑ 5.0 5.1 Johnson,J.R., B.G.Cobb and M.C.Drew (1994) Hypoxic induction of anoxia tolerance in roots of Adh1 null Zea mays L. Plant Physiol. 105: 61-67.
- ↑ 6.0 6.1 Harberd,N.P. and K.J.R. Edwards (1982) The effect of a mutation causing alcohol dehydrogenase deficiency on flooding tolerance in barley. New Phytol. 90: 631-644.
- ↑ 7.0 7.1 Jacobs,M., R.Dolferus and D.VandenBossche (1988) Isolation and biochemical analysis of ethyl methanesulfonate-induced alcohol dehydrogenase null mutants of Arabidopsis thaliana (L.) Heynh. Biochem. Genet. 26: 105-122.
- ↑ 8.0 8.1 Ellis M.H., E.S.Dennis and W.J.Peacock (1999) Arabidopsis roots and shoots have different mechanisms for hypoxic stress tolerance.Plant Physiol. 119: 57-64.
- ↑ 9.0 9.1 9.2 9.3 Matsumura,H., T.Takano, G.Takeda and H.Uchimiya (1998) Adh1 is transcriptionally active but its translational product is reduced in a rad mutant of rice (Oryza sativa L.), which is vulnerable to submergence stress. Theor. Appl. Genet. 97: 1197-1203.
- ↑ 10.0 10.1 Setter,T.L. and E.S.Ella (1994) Relationship between coleoptile elongation and alcoholic fermentation in rice exposed to anoxia.I.Importance of treatment conditions and different tissues. Ann.Bot. 74: 265 271.
- ↑ 11.0 11.1 Kato-Noguchi,H. (2001) Submergence tolerance and ethanolic fermentation in rice coleoptiles. Plant Prod. Sci. 4: 62-65.
- ↑ 12.0 12.1 Kato-Noguchi,H. and T.Kugimiya (2003) Preferential induction of alcohol dehydrogenase in coleoptiles of rice seedlings germinated in submergence condition. Biol. Plant. 46: 153-155.
- ↑ 13.0 13.1 13.2 13.3 Matsumura,H., T.Takano, K.T.Yoshida and G.Takeda (1995) A rice mutant lacking Alcohol-dehydrogenase. Breed. Sci. 45: 365-367.(1995)