Difference between revisions of "Os01g0834400"
(→Function) |
(→Function) |
||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | [[File:1.png|right|thumb|350px| '''Figure. 1''' ''(from reference <ref name="ref3" />)'']] | |
| − | + | The CCAAT-box is one of the most common promoter elements found in a large number of genes in plants. The HAP complex, which is also called NF-Y or CBF in animals, binds the CCAAT-box and regulates expression of genes.This complex consists of three distinct subunits: HAP2、HAP3、HAP5,all of which are necessary for DNA binding. Each subunit contains an evolutionary conserved domain that is responsible for DNA binding and protein-protein interaction. 10 genes for HAP2 subunit, 11 genes for HAP3 subunit and 7 genes for HAP5 subunit has been identified. HAP3A、HAP3B、HAP3C are genes encode subunits of HAP3. HAP3 genes regulate chloroplast biogenesis. In the transgenic rice plants with antisense or RNAi construct of OsHAP3A, these plants showed pale green leaves, in which the amount of chlorophyll was reduced and chloroplasts were degenerated. The thylakoid membrane was hardly generated of formed only sightly along the enveolpe, no clear grana or stroma was observed and the accumulation of the starch was not evident. Instead, an electron-dense fibre-like structure was observed in the central portion of the deformed chloroplast. The chloroplast was almost empty and smaller in size. | |
| − | + | OsHAP3A was also expressed in roots. In the antisense root, although the amount of accumulated starch was reduced, the accumulation of the starch was still observed in the amyloplasts. Showing that the OsHAP3A can also affect the amyloplast, mainly the accumulation of the starch. | |
===Expression=== | ===Expression=== | ||
Revision as of 07:11, 31 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
The CCAAT-box is one of the most common promoter elements found in a large number of genes in plants. The HAP complex, which is also called NF-Y or CBF in animals, binds the CCAAT-box and regulates expression of genes.This complex consists of three distinct subunits: HAP2、HAP3、HAP5,all of which are necessary for DNA binding. Each subunit contains an evolutionary conserved domain that is responsible for DNA binding and protein-protein interaction. 10 genes for HAP2 subunit, 11 genes for HAP3 subunit and 7 genes for HAP5 subunit has been identified. HAP3A、HAP3B、HAP3C are genes encode subunits of HAP3. HAP3 genes regulate chloroplast biogenesis. In the transgenic rice plants with antisense or RNAi construct of OsHAP3A, these plants showed pale green leaves, in which the amount of chlorophyll was reduced and chloroplasts were degenerated. The thylakoid membrane was hardly generated of formed only sightly along the enveolpe, no clear grana or stroma was observed and the accumulation of the starch was not evident. Instead, an electron-dense fibre-like structure was observed in the central portion of the deformed chloroplast. The chloroplast was almost empty and smaller in size. OsHAP3A was also expressed in roots. In the antisense root, although the amount of accumulated starch was reduced, the accumulation of the starch was still observed in the amyloplasts. Showing that the OsHAP3A can also affect the amyloplast, mainly the accumulation of the starch.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os01g0834400 |
|---|---|
| Description |
Similar to HAP3 |
| Version |
NM_001185707.1 GI:297720548 GeneID:9268285 |
| Length |
2312 bp |
| Definition |
Oryza sativa Japonica Group Os01g0834400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:37512199..37514510 |
| Sequence Coding Region |
37512340..37512558 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:37512199..37514510 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:37512199..37514510 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>aagactaaagcacttgaagggtgttggtttagaaagggtgttaacagttggctgtggcgattgcttcacagatgtaaattgcttcataagtggtttaatgcttgtttttgcctgtatattcagagcaattttcacatattggtagttctgcaatcttttgcattcccatacatgtatcaggtggcacaaatctattgcaagtaccctagcattgaataa</cdnaseq> |
| Protein Sequence |
<aaseq>KTKALEGCWFRKGVNSWLWRLLHRCKLLHKWFNACFCLYIQSNF HILVVLQSFAFPYMYQVAQIYCKYPSIE</aaseq> |
| Gene Sequence |
<dnaseqindica>1953..2171#aaccgccgtctcctcctccccccactctcgccttcccccctctctctcctctcctctccgcgactccctccacccccgcgcgcgcgcgttttttttttttcgtaaggtacggatccaacgacgctgctcggctgctcctctccccaccaccatctctgatggtttgttgctgtgatgatgatgatggatctagggtttttggagggcggcgcggggatggcggacgcggggcacgacgagagcgggagcccgccgaggagcggcggggtgagggagcaggacaggttcctgcccatcgccaacatcagccgcatcatgaagaaggccgtcccggcgaacggcaagatcgccaaggacgccaaggagaccctgcaggagtgcgtctcggagttcatctccttcgtcaccagcgagtgagtctgcgcgggctcggtaccgtgatcctgccctccccacaccttcttttgtgatggttggtttagggtgtgattttgctttgctttgtggtttgggcggtggtgcgggatgggacagggcgagcgacaaatgtcagaaggagaagcgcaagaccatcaacggggaagatctcctctttgcgatgggtacgcttggctttgaggagtacgttgatccgttgaagatctatttacacaagtacagagaggtaattgtgcgcttcgtactctctgccagtataaatgttaaacctttcgttgttgtatgaatatctgatgtctcttctgtcctcctggcaaatttgcaatacgtggggatgtgcactgttaactgcagatggaggtacaccatctaccattctaccctcctcaaaatccccttttttccccaacaatatgctatggtttcatgtgaattttttttttgtcaacgcaaaaatgtgtcactcttgtaatcctgcttttagaacaatcccacaaaaaattgatatgcaattatgccctttgattagagatagttggtgctcaacatgaaatgtacatatcctactctgaactgtaaggttaacacctgaatcattctttcattcctctgcttcatatacattgaaggaaagctaaccgcatccatttagtatgtcactgttcaatttgcctggaaatatatatttgtgccttagtaatactctaagatctatatttgtgccttagtaaaagatctatttttgtgcatcaagattcaagatgtattgagttctaaccataccactattccttattcttggtagggtgatagtaagctgtcctcaaaggctggtgatggttcagtaaagaaggatacaattggtccgcacagtggcgctagtagctcaagtgcgcaaggggttggtatcagtaacttgtactgctttgttctttctgatgtttgaaaacactgacatactgataatatttttagatggttggggcttacacccaagggatgggttatatgcaacctcaggtaacctagcactagcatagtatcatttgtcagcacaatgctatggttcatccttgaagctaaacaagatataaagtaataatgcacattcaactttttttttctagctgacactgtttatgccattacacgtgcagtatcataatggggacacctaaagatgaggacagtgaaaattttcagtaactggtgtcctctgtgaggtaagatcttttgtacagaaatcatttgccatccttggggcagttttcagttagatgtttttttcactaaaaattgcccgttctgtctcaaggttcacatatactacatctgtatttttttattctttttacatgtgaactctggagatgttgagctgcacatgtgaaaaattctccgagtgcttttatactttttcgcgctcttctagttctgacacaatactcccttttgctgcagttattatccatctgttaaggaagaacccacattagggccatatttattagtagaagactaaagcacttgaagggtgttggtttagaaagggtgttaacagttggctgtggcgattgcttcacagatgtaaattgcttcataagtggtttaatgcttgtttttgcctgtatattcagagcaattttcacatattggtagttctgcaatcttttgcattcccatacatgtatcaggtggcacaaatctattgcaagtaccctagcattgaataatgctggttaacatataattctgtaacgtccgtattgtttcgactgtgatgcttgccgtatgggcaatggcatgtgttctagagggggcattcaatatttaggtatctcaagaatgtaccaaatactcccttcgttcaattc</dnaseqindica> |
| External Link(s) |
- ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref3