Difference between revisions of "Os01g0834400"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
Line 14: Line 14:
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
[[File:文件名|top|thumb|Expression.png| ''expression patterns of OsHAP3 genges (from reference <ref name="ref2" />)'']]
 +
RNAs isolated from indicated organs were analysed by RT-PCR. Actin was used for an internal control. OsHAP3A,  OsHAP3B,  OsHAP3C showed ubiquitous expression. They were expressed in all organs examined such as shoot apices, roots, young panicles, flowering panicles, young leaves, developing embryos and their surrounding tissues at 0, 2, 4, 6 and 8 Days after pollination, and regenerating calli at 0, 2, 4, 6 days after regeneration. The expression wwas also observed in developing young inflorescence with a panicle length of 1 and 3 mm, 2 and 3 cm.
  
 
===Evolution===
 
===Evolution===

Revision as of 07:56, 31 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Figure. 1 (from reference [1])

The CCAAT-box is one of the most common promoter elements found in a large number of genes in plants. The HAP complex, which is also called NF-Y or CBF in animals, binds the CCAAT-box and regulates expression of genes.This complex consists of three distinct subunits: HAP2、HAP3、HAP5,all of which are necessary for DNA binding. Each subunit contains an evolutionary conserved domain that is responsible for DNA binding and protein-protein interaction. 10 genes for HAP2 subunit, 11 genes for HAP3 subunit and 7 genes for HAP5 subunit has been identified. HAP3A、HAP3B、HAP3C are genes encode subunits of HAP3. HAP3 genes regulate chloroplast biogenesis. In the transgenic rice plants with antisense or RNAi construct of OsHAP3A, these plants showed pale green leaves, in which the amount of chlorophyll was reduced and chloroplasts were degenerated. The thylakoid membrane was hardly generated of formed only sightly along the enveolpe, no clear grana or stroma was observed and the accumulation of the starch was not evident. Instead, an electron-dense fibre-like structure was observed in the central portion of the deformed chloroplast. The chloroplast was almost empty and smaller in size.
OsHAP3A was also expressed in roots. In the antisense root, although the amount of accumulated starch was reduced, the accumulation of the starch was still observed in the amyloplasts. Showing that the OsHAP3A can also affect the amyloplast, mainly the accumulation of the starch.
a. The chloroplast of the antisense plant #31. A membrane structure of the chloroplasts was not well developed and no accumulation of starch grains was observed
b. Electron-dense fibre-like structure was observed.
c. The amyloplast of the antisense plant #31. The reduced amount of the starch was accumulated.
d. The chloroplast of the antisense plant #56. Almost no membrane structure was observed inside the chloroplast. The chloroplast was small.
e. The inside of the chloroplast was almost empty.
f. The amyloplast of the antisense plant #56. The reduced amount of the starch was accumulated.

Expression

File:文件名
expression patterns of OsHAP3 genges (from reference [2])

RNAs isolated from indicated organs were analysed by RT-PCR. Actin was used for an internal control. OsHAP3A, OsHAP3B, OsHAP3C showed ubiquitous expression. They were expressed in all organs examined such as shoot apices, roots, young panicles, flowering panicles, young leaves, developing embryos and their surrounding tissues at 0, 2, 4, 6 and 8 Days after pollination, and regenerating calli at 0, 2, 4, 6 days after regeneration. The expression wwas also observed in developing young inflorescence with a panicle length of 1 and 3 mm, 2 and 3 cm.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0834400

Description

Similar to HAP3

Version

NM_001185707.1 GI:297720548 GeneID:9268285

Length

2312 bp

Definition

Oryza sativa Japonica Group Os01g0834400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:37512199..37514510

Sequence Coding Region

37512340..37512558

Expression

GEO Profiles:Os01g0834400

Genome Context

<gbrowseImage1> name=NC_008394:37512199..37514510 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:37512199..37514510 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>aagactaaagcacttgaagggtgttggtttagaaagggtgttaacagttggctgtggcgattgcttcacagatgtaaattgcttcataagtggtttaatgcttgtttttgcctgtatattcagagcaattttcacatattggtagttctgcaatcttttgcattcccatacatgtatcaggtggcacaaatctattgcaagtaccctagcattgaataa</cdnaseq>

Protein Sequence

<aaseq>KTKALEGCWFRKGVNSWLWRLLHRCKLLHKWFNACFCLYIQSNF HILVVLQSFAFPYMYQVAQIYCKYPSIE</aaseq>

Gene Sequence

<dnaseqindica>1953..2171#aaccgccgtctcctcctccccccactctcgccttcccccctctctctcctctcctctccgcgactccctccacccccgcgcgcgcgcgttttttttttttcgtaaggtacggatccaacgacgctgctcggctgctcctctccccaccaccatctctgatggtttgttgctgtgatgatgatgatggatctagggtttttggagggcggcgcggggatggcggacgcggggcacgacgagagcgggagcccgccgaggagcggcggggtgagggagcaggacaggttcctgcccatcgccaacatcagccgcatcatgaagaaggccgtcccggcgaacggcaagatcgccaaggacgccaaggagaccctgcaggagtgcgtctcggagttcatctccttcgtcaccagcgagtgagtctgcgcgggctcggtaccgtgatcctgccctccccacaccttcttttgtgatggttggtttagggtgtgattttgctttgctttgtggtttgggcggtggtgcgggatgggacagggcgagcgacaaatgtcagaaggagaagcgcaagaccatcaacggggaagatctcctctttgcgatgggtacgcttggctttgaggagtacgttgatccgttgaagatctatttacacaagtacagagaggtaattgtgcgcttcgtactctctgccagtataaatgttaaacctttcgttgttgtatgaatatctgatgtctcttctgtcctcctggcaaatttgcaatacgtggggatgtgcactgttaactgcagatggaggtacaccatctaccattctaccctcctcaaaatccccttttttccccaacaatatgctatggtttcatgtgaattttttttttgtcaacgcaaaaatgtgtcactcttgtaatcctgcttttagaacaatcccacaaaaaattgatatgcaattatgccctttgattagagatagttggtgctcaacatgaaatgtacatatcctactctgaactgtaaggttaacacctgaatcattctttcattcctctgcttcatatacattgaaggaaagctaaccgcatccatttagtatgtcactgttcaatttgcctggaaatatatatttgtgccttagtaatactctaagatctatatttgtgccttagtaaaagatctatttttgtgcatcaagattcaagatgtattgagttctaaccataccactattccttattcttggtagggtgatagtaagctgtcctcaaaggctggtgatggttcagtaaagaaggatacaattggtccgcacagtggcgctagtagctcaagtgcgcaaggggttggtatcagtaacttgtactgctttgttctttctgatgtttgaaaacactgacatactgataatatttttagatggttggggcttacacccaagggatgggttatatgcaacctcaggtaacctagcactagcatagtatcatttgtcagcacaatgctatggttcatccttgaagctaaacaagatataaagtaataatgcacattcaactttttttttctagctgacactgtttatgccattacacgtgcagtatcataatggggacacctaaagatgaggacagtgaaaattttcagtaactggtgtcctctgtgaggtaagatcttttgtacagaaatcatttgccatccttggggcagttttcagttagatgtttttttcactaaaaattgcccgttctgtctcaaggttcacatatactacatctgtatttttttattctttttacatgtgaactctggagatgttgagctgcacatgtgaaaaattctccgagtgcttttatactttttcgcgctcttctagttctgacacaatactcccttttgctgcagttattatccatctgttaaggaagaacccacattagggccatatttattagtagaagactaaagcacttgaagggtgttggtttagaaagggtgttaacagttggctgtggcgattgcttcacagatgtaaattgcttcataagtggtttaatgcttgtttttgcctgtatattcagagcaattttcacatattggtagttctgcaatcttttgcattcccatacatgtatcaggtggcacaaatctattgcaagtaccctagcattgaataatgctggttaacatataattctgtaacgtccgtattgtttcgactgtgatgcttgccgtatgggcaatggcatgtgttctagagggggcattcaatatttaggtatctcaagaatgtaccaaatactcccttcgttcaattc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0834400, RefSeq:Os01g0834400

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2