Difference between revisions of "Os10g0561400"

From RiceWiki
Jump to: navigation, search
(References)
(Annotated Information)
Line 4: Line 4:
 
OsMYBS3 is a single DNA-binding repeat MYB transcription factor to mediate sugar signaling and plays a critical role in cold adaptation in rice.
 
OsMYBS3 is a single DNA-binding repeat MYB transcription factor to mediate sugar signaling and plays a critical role in cold adaptation in rice.
 
===Function===
 
===Function===
OsMYBS3 acts as a repressor, in sugar starvation–induced α-amylase gene expression. As a repressor, whether OsMYBS3 plays a negative role in the sugar regulation ofα-amylase gene expression is not clear. OsMYBS3 is most abundant in senescent leaves, in which sugars are depleted as a result of their transport to other tissues. OsMYBS3 may preventα-amylase genes from being induced by the low sugar level in senescent leaves, which would be a wasteful process in dying cells..<ref name="ref1">
+
OsMYBS3 acts as a repressor, in sugar starvation–induced α-amylase gene expression. As a repressor, whether OsMYBS3 plays a negative role in the sugar regulation ofα-amylase gene expression is not clear. OsMYBS3 is most abundant in senescent leaves, in which sugars are depleted as a result of their transport to other tissues. OsMYBS3 may preventα-amylase genes from being induced by the low sugar level in senescent leaves, which would be a wasteful process in dying cells..<ref name="ref1"/>
  
 
===Expression===
 
===Expression===
The open reading frames of OsMYBS1, OsMYBS2, and OsMYBS3 encode polypeptides of 306, 276, and 318 amino acid residues, respectively. The three OsMYBSs contain a highly conserved single DNA binding domain that is very similar to the DNA binding domains of other mammalian, Drosophila, and plant. OsMYBS3 is expressed in all tissues, with the highest level in senescent leaves. The levels of OsMYBS3 mRNAs are low in the presence of Suc but increase in the absence of Suc which were parallel to the mRNA levels of α-Amy3 and another rice α-amylase gene, α-Amy8. OsMYBS3 is suppressed in the presence of Glc or GA but remains unchanged in the presence of abscisic acid. OsMYBS3 doesn't significantly enhance luciferase activity in the presence of Glc and repressed luciferase activity in the absence of Glc.  OsMYBS3 may serve as a repressor, for transcription of the promoter containing SRS.<ref name="1" /> OsMYBS3 in rice are enhanced by ABA and abiotic stresses <ref name="ref3"> and cold stress conditions <ref name="ref4">, respectively.In addition, OsMYBS3 in rice regulates the expression of cold-related genes such as WRKY77 and Glu decarboxylase, both of which contain a TATCCA element in their promoters. <ref name="ref4"/>
+
The open reading frames of OsMYBS1, OsMYBS2, and OsMYBS3 encode polypeptides of 306, 276, and 318 amino acid residues, respectively. The three OsMYBSs contain a highly conserved single DNA binding domain that is very similar to the DNA binding domains of other mammalian, Drosophila, and plant. OsMYBS3 is expressed in all tissues, with the highest level in senescent leaves. The levels of OsMYBS3 mRNAs are low in the presence of Suc but increase in the absence of Suc which were parallel to the mRNA levels of α-Amy3 and another rice α-amylase gene, α-Amy8. OsMYBS3 is suppressed in the presence of Glc or GA but remains unchanged in the presence of abscisic acid. OsMYBS3 doesn't significantly enhance luciferase activity in the presence of Glc and repressed luciferase activity in the absence of Glc.  OsMYBS3 may serve as a repressor, for transcription of the promoter containing SRS.<ref name="1"/> OsMYBS3 in rice are enhanced by ABA and abiotic stresses <ref name="ref3"/> and cold stress conditions <ref name="ref4"/>, respectively.In addition, OsMYBS3 in rice regulates the expression of cold-related genes such as WRKY77 and Glu decarboxylase, both of which contain a TATCCA element in their promoters. <ref name="ref4"/>
  
 
===Evolution===
 
===Evolution===
OsMYBS3 is rich in both Pro (19 of 166 amino acids, or 11%) and acidic amino acids (22 of 166 amino acids, or 13%). It is not clear why OsMYBS2 and OsMYBS3 do not form homodimers by themselves and why the three Os-MYBSs do not form heterodimers with each other.<ref name="1" /> Barley HvMYBS3, rice OsMYBS3 and maize ZmMYBSt1 are probably orthologous, because, in addition to the 100% identity of their DBD, they share 84.6% and 80.9% identical residues, respectively, along their whole protein sequences (WPS). <ref name="ref2">
+
OsMYBS3 is rich in both Pro (19 of 166 amino acids, or 11%) and acidic amino acids (22 of 166 amino acids, or 13%). It is not clear why OsMYBS2 and OsMYBS3 do not form homodimers by themselves and why the three Os-MYBSs do not form heterodimers with each other.<ref name="1" /> Barley HvMYBS3, rice OsMYBS3 and maize ZmMYBSt1 are probably orthologous, because, in addition to the 100% identity of their DBD, they share 84.6% and 80.9% identical residues, respectively, along their whole protein sequences (WPS). <ref name="ref2"/>
  
 
== References ==
 
== References ==

Revision as of 13:47, 31 May 2014

Please input one-sentence summary here.

Annotated Information

OsMYBS3 is a single DNA-binding repeat MYB transcription factor to mediate sugar signaling and plays a critical role in cold adaptation in rice.

Function

OsMYBS3 acts as a repressor, in sugar starvation–induced α-amylase gene expression. As a repressor, whether OsMYBS3 plays a negative role in the sugar regulation ofα-amylase gene expression is not clear. OsMYBS3 is most abundant in senescent leaves, in which sugars are depleted as a result of their transport to other tissues. OsMYBS3 may preventα-amylase genes from being induced by the low sugar level in senescent leaves, which would be a wasteful process in dying cells..[1]

Expression

The open reading frames of OsMYBS1, OsMYBS2, and OsMYBS3 encode polypeptides of 306, 276, and 318 amino acid residues, respectively. The three OsMYBSs contain a highly conserved single DNA binding domain that is very similar to the DNA binding domains of other mammalian, Drosophila, and plant. OsMYBS3 is expressed in all tissues, with the highest level in senescent leaves. The levels of OsMYBS3 mRNAs are low in the presence of Suc but increase in the absence of Suc which were parallel to the mRNA levels of α-Amy3 and another rice α-amylase gene, α-Amy8. OsMYBS3 is suppressed in the presence of Glc or GA but remains unchanged in the presence of abscisic acid. OsMYBS3 doesn't significantly enhance luciferase activity in the presence of Glc and repressed luciferase activity in the absence of Glc. OsMYBS3 may serve as a repressor, for transcription of the promoter containing SRS.Cite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title OsMYBS3 in rice are enhanced by ABA and abiotic stresses [2] and cold stress conditions [3], respectively.In addition, OsMYBS3 in rice regulates the expression of cold-related genes such as WRKY77 and Glu decarboxylase, both of which contain a TATCCA element in their promoters. [3]

Evolution

OsMYBS3 is rich in both Pro (19 of 166 amino acids, or 11%) and acidic amino acids (22 of 166 amino acids, or 13%). It is not clear why OsMYBS2 and OsMYBS3 do not form homodimers by themselves and why the three Os-MYBSs do not form heterodimers with each other.Cite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title Barley HvMYBS3, rice OsMYBS3 and maize ZmMYBSt1 are probably orthologous, because, in addition to the 100% identity of their DBD, they share 84.6% and 80.9% identical residues, respectively, along their whole protein sequences (WPS). [4]

References

  1. Lu C A, Ho T D, Ho S L, et al. Three novel MYB proteins with one DNA binding repeat mediate sugar and hormone regulation of α-amylase gene expression[J]. The Plant Cell Online, 2002, 14(8): 1963-1980.
  2. Liao Y, Zou HF, Wang HW, Zhang WK, Ma B, Zhang JS, Chen SY (2008) Soybean GmMYB76, GmMYB92, and GmMYB177 genes confer stress tolerance in transgenic Arabidopsis plants. Cell Res 18: 1047–1060.
  3. 3.0 3.1 Su C F, Wang Y C, Hsieh T H, et al. A novel MYBS3-dependent pathway confers cold tolerance in rice[J]. Plant physiology, 2010, 153(1): 145-158.
  4. Rubio‐Somoza I, Martinez M, Abraham Z, et al. Ternary complex formation between HvMYBS3 and other factors involved in transcriptional control in barley seeds[J]. The Plant Journal, 2006, 47(2): 269-281.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.

Structured Information

Gene Name

Os10g0561400

Description

Similar to Transcription factor MYBS3

Version

NM_001071918.1 GI:115483431 GeneID:4349385

Length

8307 bp

Definition

Oryza sativa Japonica Group Os10g0561400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:22583739..22592045

Sequence Coding Region

22584003..22584473,22584753..22584961,22588740..22588764

Expression

GEO Profiles:Os10g0561400

Genome Context

<gbrowseImage1> name=NC_008403:22583739..22592045 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:22583739..22592045 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgttattcgcgttggacgaggcaggtgttccttggactgaagaagaacaccggaggtttttgcttggattgcaaaagcttggcaaaggtgattggcgaggaatctctcgtaatttcgtggtctcaagaacacctactcaagtagccagtcatgctcagaaatattttatacgccaatccaatatgaccagaaggaaaagaaggtctagcctttttgacatggtgccagatgagtctatggaccttccaccacttcctggaggtcaagaaccagagacccaagtattaaatcaaccagcactacctccaccgagggaggaggaggaggtagattctatggagtcagatacttctgccgttgcagagagctcttccgcttctgctatcatgccagataatttgcagtcgacctatccagtgattgttccagcttatttctcgccctttttgcaattctcggttcctttctggcaaaatcagaaagatgaagatggtcctgtgcaagaaacacatgagattgtcaagcctgttccagttcattcaaagagcccaatcaacgttgatgagcttgttggcatgtcgaagctcagcataggagagtccaatcaagagacagtgtctacttctctttcattaaatctggtaggaggtcaaaatagacaatcagctttccatgcaaatccaccaacaagggcacaggcatga</cdnaseq>

Protein Sequence

<aaseq>MLFALDEAGVPWTEEEHRRFLLGLQKLGKGDWRGISRNFVVSRT PTQVASHAQKYFIRQSNMTRRKRRSSLFDMVPDESMDLPPLPGGQEPETQVLNQPALP PPREEEEVDSMESDTSAVAESSSASAIMPDNLQSTYPVIVPAYFSPFLQFSVPFWQNQ KDEDGPVQETHEIVKPVPVHSKSPINVDELVGMSKLSIGESNQETVSTSLSLNLVGGQ NRQSAFHANPPTRAQA</aaseq>

Gene Sequence

<dnaseqindica>7573..8043#7085..7293#3282..3306#agaggcgcgcgtcgccgtcgggcggcggcgaagccggagatggcggggacgccggggaggcgccctccggcagccggctccgcgccgcagcggaatccgaccggaggcaggtagataagtatcctgctcctcttccctcgcgttccagctcgcgaagtccccgtttaatttgattttgtatgcgtttttgctgggtagggttatggtatgtactagggtgtgttcgttcggggatggcgactagttcttcgagctttcgccggaggggaagatggcggtgcggccctcggggaaagaggggtaaggatttttcagtgcttgcctcttgggctcgtggtgaactggtgatagcttggagtgtgaggggatcgtcgacaaccgtggcgtgtgcttcgattattgcttaatttgttcaggttacgcgcgactctgtcagccagatgtagttggagagccttttgtcatatcctcatactgcctgtagttcgagacaaaaatcatattttcgaatattttacttttttgggatggttgctacgatgcagttgagtggttcagttgtgattggtgattgtctgtgtaggatgcatcaagcggtatttctgatttgggcctctggaagatggatttgagtgatgatgtgtaccaattgctttctgaaggtacttgtctgcttcgccatttctcaacaactgataaatttgtcaaatgtaaccgttcatttttacttggacgttcatcattcagttgatttgatgtcctttccaagctttgcttcttaaaaggacaaaagaatatttctatatttgtccggccaaattatctttagaacactttccatcttgaaaggcgtcaatgaaactgtactgtgcaaatctgccataggcatttttgatttggtattgtgcaaacaactacagcattctagaactgtatcacaagttcacaacccactttctatcactcttgctcattgcacattcatatcttgtttcagagaactgtttactccactgttgttgcttatatttcccttcaagtttgggacctgattctgaattctttcagaacaatggtgcacgttactgctgatcagcactattcggtcaataatgcagtgcagtcataagtgcaccatttcaagtgtatttgttagttggtactaaatatctgtgcattacagtgtttatatgatactaaaactcttcatgccagaacatttttagtttagtaagaaaccataaggtccaaaatggttggttcagtgttcagactagcagctcggcaaaatcttcttactaatgtttcagattaattatattgctgccatatactgggtgcgtatgattgagaaaattaaatctattaggtaacataaatatggttggttcagtgttcagactagcatctcagcaaaatcttcttactaatgtttcagattaattatattgctgccatatactgggtgcgtatgattgagaaaattaaatctattaggtaacataaatataaggcgtgtaggcttctgggctctggagtaccgttgttttgtgcaatgttcaactgagttgtttttaaactagagaatgagatataaacagaaaacaaatcatgaatcttcttattctttttaatgaactgactgtgtttctttatcattgttgatccagccgagcaacttttttaagtttatcttttatttccatacatcttatctctttgttttattgaaatggatttgtttatcaattcaataccagtgaagcatatgaatctgatgatggaaactgttgcaacggcacattcggaatatgccaatatggaatggctacccttgcctgcaggtatgctatctttttcacaacttttaattcatcaagttctgttctttctttagattatcactcacgtaaacaatatatatccacctgttgatatggtcctgtactccagtgtcagtttttttatatataaaaaaagatatggtccagtcactgctgatggatcctaacttatattttattcgataatttgaagatatatgctagtatcttgcaagggatattttgtccaactgcatcaacaaaattaggcatcaagatttggatgttggtaagcacatcctctctctagatcggtgcaagtgcaacctccgtcttgaatcttgatgacattagatgagaatatctccacacgaaaataatataggccattgctcactcagttgcttacatactctgttttactttagattatgatgcctttctacttcaaataggtaaatactctttagtacagaatataaaaaaaaggtaatatctctgtaacaagcaagtcactgtcaaaattatcctaacaccttcaagtttttgctatttttattaactgcgcccttgattgatccgtgactgtcatttttctttgacgcgttccgtgatagtcatggcttaggattaccgtgcataagggataaaggtgcatgctgatcgattgccgactttttgagtgtttagccacgctttttcttaacttatcctctttggtccgttcaaccccatggatgcaattttaattagttgcgagcagaaagcatattgttggcttagataagctgtcactgtttcgtgcttgtagcaatatgataatacagaatgcagtagtagaccgacaacattgtcccccggttttacgagtggtagaccgacaataatccacctctcgcggtggatcccttttgacttgcaggttaattacttcaggttcagatccgttgattgctcgtgttcttgaaaatataatactcctgtttttacatccttgctatagttatcatgatcaccttgccgtacgttcgttggctttgattaatctggtgatttggttcaagatgatgtggtgtatacattttccatgcatttttctttggcttctttcggcatggactgacttgtgtttgtgttggttgttgcagtccgtaggataggatgagctgatgatgagcagctgcagctcgcaggattatttatttgtcgtggaagctggtgtgcaacgtctacgaattcgtgtaccagactacccttatatataagtactccgtatacatacaggtacgaaaaaaacgcgaatagtagagaaaaatttaatattaaataaatagaatagatgagtctttgaatccagatcaattagctaaccacttgtgaagctagccagaaaataaatccatgtacgtttctctactacaggtacgcgcacggtcggccacaccttgagctgcacgaatgttattcgcgttggacgaggcaggtgcgttacatgcttgtgtgtgcaagttgcggcctcatcgcgtttgtgtggctgtctcgttgtcgtccggatttttggatttttggtccgcacgcgcgcgccacgggtccgatcgatgatatcgtcatccctgccgtgctcgtacgggtcacgctcaagtgataccatgctcgccctggttcccaaacctccaatgccaccatgtgtttcaccagttgtgtgcctgcagcccacatggaaaatatatacggagtataaatctagggcctgctcactttgctattatttttaaccttattaagttttggcattatcaaattttggtaaggttatcaaaattttagcaaggttgtcaaattttgacaagattttatatgtacttactaaaatttggcaacaaactaaatgtagctacttttttaagtaactttgccaaaacttgataaggttgaaaatgatagcaaactgaacaagcctcgatttatgcttgcagaaagagtgagtgcacattttaggtcccatgaaatacatacacgtacatagctatcagcgtgtcctcgtaatacacattcaaatagcatcaataattcctttcccttactctataggaagcataattccttatatagagtataggttgatgcatatataaacgaatcatagcataccacatgacactaacttgataaaggttgtataatctttagactcaacatctactataaagacgcatatttatggacctcgtggatggactccaccatcatattaatattgtctctccaataggatcgataggtaaaaatgtcattagcattattgtcttctaatgtgaaacaaagtgagcgttctacaaaaatatttgacatcctcgtgttggagttcaaatttacaatctcaatgctttagcctatacaaaatcacctatgtagaattgtaatctcaccgacctgcttgagatgccattggtgttaattttctccttttgtttcttccttctcttcttcttcggtttcttttcttctcttcttttttcatcaccgagggcttcccgagatcacctcacgaatcctttctagtgcaagttttagggtttaggcaaagagtacgacatcccttctcctttgcctttcatctctttatataggcgctggtggggctcgagggttatctccaatttggttaggaattagttctactgttcacaaaactaactctccgtctttaggaatcagatacgtgtgatttatcttccttatctagctggcatttagctgataaaatcaaccaaaacctggtattgatagttatagtgagacaaacctctaatcctcaactattcaggatttacgttcacccgtggcacattagggttacatggtacaccaagaagcaacacatttagaatccataaactttttggcgtagaataatccgtgcatttttcatctttagttaacgtctgtttagttacgagtagaagagttaaaccagaccatgacatcgctcaaaagaaaaaaaacaagaaaagaaagaaagaccacgacagtttgacgagctagcagcgagagagagtttgttgggggccgtttgctgtggatcgttcaccagtcaccacacgaaacgatcgaagcagaggctgaggctgaggagagcagccgaaggaaggaagcccaaccgcgtggacggatagaaagaaggcgtgacccacaagccgccgctacttgcctccctcgtctcacgtatatccccttcccccgaatatccgccacgtggacggccctcgcctctctccgaccaccttaaccaatcaccacacagcagttaacccctctcctccccttcctcttctcccccctccctctcctcgtcgtctccaccaccaccatctccgtctccactcgatcgatcgatcgatctccataggtgggggaagggaagctttggaaggtggagggacggagggggggatgacgaggcggtgctcgcactgcagccacaacgggcacaactcgcggacgtgccccaaccgcggggtcaagatcttcggggtgcgcctcaccgatggctccatccgcaagagcgccagcatggggaacctctccctcctctcctccgccgccggatccaccagcggcggcgcctcccccgccgacggccccgacgccgcccccaccgccgccgacggctacgcctccgacgacttcgtccagggctcctcctccgccacccgcgaccgcaagaagggtcagcccccccccttcttcttctttcccaaccccttaatttcaatgatttaatcatcccaaaaaccattctggcctgatgcgacttactagatcctctccaacctcaggtttttcttcttcttgtgcttctttttttattattattcctactagtatgttcttcttcctttgctgcttcggcgtgtagatttgggagatttgatggagtactgctactagcagtcactgctagttgtttcttccaagtaggacagacgctagagaaagcatttaatgggcagattgtactgatggtcatggatgagtgatttggtactacttagctcatgcatacgccactccacttcaattaattactctcggtacaaggacggcgtatagatgcctccaactgtttgatgagatcacaaggacgttttgtcaaactcatgctcagctccatatttgtctaggataagtaagaatttagaatcagaccagatcgttccaacgagtaatgatggctgatcctgtggaactttttaatttgatcctttgcctctgcaaggatgcatggggccacgtgttctgagaggataacagtgtcgaattagggattttgtgagtggctggtaactaggctcagtgttctcatgtttagacacccgatcatcggagattggaacctatgattgcgtacggtgttgttagctctgttctgattcagaatgatttctagtttactgcgtagttatattcgcggtgttggtccaagaaaagtcttccaagctgtcagctttcaaaacccaagaaccttcctaatggcatgcctatgttaatgtgtgaaagcttcaaagcagcacgtgattgtttgatctttactgtggcagtagttcctactgtaacggccttactagaggtcatgccattggtagactgcgttgtcattgcctcattaacttgtacttccatccaaatttgatgcttggagtgcagttttagacttatatgcctactgacttaaatgtattggaaaagtcaaaagtatatgtttgtcctttatcaatttgtaatgaaaggcactaaattggataaaagaaatcgccttgaaatgtacaatttgctattcttttgacatttattctgttaagaggattatgccagattgacaatgttttaatcttgttaaccttctgcataacttgttaaggtggcaaaagacataaaatttgtctctttcccttttatgttctggcatttctcttggaatctcatagaatccttttactttttaagattggagtcctctctctgtgcgccctgtttcttaggaacgggctcttttttgggctggataattttcctttggtgataggcagtactgttattttgtgtagtagtcccaagtttgttggtatttttgtcagtatatgatgggagcttaactattacagttctccagcttcttgtactccagtcattactcgctacctgcgtgcctgcaggccacattctgtgtgccatgtttctgattaagatgactttgacaggtgttccttggactgaagaagaacaccggaggtttttgcttggattgcaaaagcttggcaaaggtgattggcgaggaatctctcgtaatttcgtggtctcaagaacacctactcaagtagccagtcatgctcagaaatattttatacgccaatccaatatgaccagaaggaaaagaaggtctagcctttttgacatggtgccagatgaggtagcttgcttgatcttatttcgattattgtgctgatattggcatgtagcataataagcctgcctgggtctattcttatattgagacgaggagattgctcatttgtgtggtgatagatatcatattgctaaaacttatctttttgaacaaattgtgtagtttatttatgtattgcatgaagacttgagaacacttttatccttgttcgaattagaaaggttgtactgttttctctgtactctaatgggggaactgaactgtgttttggtggttttacagtctatggaccttccaccacttcctggaggtcaagaaccagagacccaagtattaaatcaaccagcactacctccaccgagggaggaggaggaggtagattctatggagtcagatacttctgccgttgcagagagctcttccgcttctgctatcatgccagataatttgcagtcgacctatccagtgattgttccagcttatttctcgccctttttgcaattctcggttcctttctggcaaaatcagaaagatgaagatggtcctgtgcaagaaacacatgagattgtcaagcctgttccagttcattcaaagagcccaatcaacgttgatgagcttgttggcatgtcgaagctcagcataggagagtccaatcaagagacagtgtctacttctctttcattaaatctggtaggaggtcaaaatagacaatcagctttccatgcaaatccaccaacaagggcacaggcatgatctccttctgcacacaactgcatttagatgaatcccaggcaaaataagctttgcctccttgtttttttgtttttattttaagattaaccgttctccgtagtctgtatcatgtgctgtaagttatgctatgtatgaatgtatctgttgtttgtctggcacacatgataaatcactctatgttaacaaaatcagtaatggtagtgctgatcttcgtggttgtactgttgtaaactcttttataagaaaaaaaaatattagttagtc</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0561400, RefSeq:Os10g0561400