Difference between revisions of "Os02g0641300"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
    MYB proteins are a superfamily of transcription factors that play regulatory roles in developmental processes and defense responses in plants1. Relevant research indicated that the GAMyb is the sole GA-regulated transcription factor required for transcriptional activation of the high-pl a-amylase promoter. We therefore postulate that GAMyb is a part of the GA-response pathway leading to a-amylase gene expression in aleurone cells3. In a transient transactivation experiment using Arabidopsis leaf protoplasts, researchers demonstrated that the ATMYB2 proteins activate transcription of the rd22 promoter fused to the β-glucuronidase reporter gene. This results indicate that the ATMYB2 (MYB) proteins function as transcriptional activators in the dehydration- and ABA-inducible expression of the rd22 gene4.
+
  MYB proteins are a superfamily of transcription factors that play regulatory roles in developmental processes and defense responses in plants1. Relevant research indicated that the GAMyb is the sole GA-regulated transcription factor required for transcriptional activation of the high-pl a-amylase promoter. We therefore postulate that GAMyb is a part of the GA-response pathway leading to a-amylase gene expression in aleurone cells3. In a transient transactivation experiment using Arabidopsis leaf protoplasts, researchers demonstrated that the ATMYB2 proteins activate transcription of the rd22 promoter fused to the β-glucuronidase reporter gene. This results indicate that the ATMYB2 (MYB) proteins function as transcriptional activators in the dehydration- and ABA-inducible expression of the rd22 gene4.
  
 
===Expression===
 
===Expression===

Revision as of 23:30, 31 May 2014

Please input one-sentence summary here.

Annotated Information

Function

 MYB proteins are a superfamily of transcription factors that play regulatory roles in developmental processes and defense responses in plants1. Relevant research indicated that the GAMyb is the sole GA-regulated transcription factor required for transcriptional activation of the high-pl a-amylase promoter. We therefore postulate that GAMyb is a part of the GA-response pathway leading to a-amylase gene expression in aleurone cells3. In a transient transactivation experiment using Arabidopsis leaf protoplasts, researchers demonstrated that the ATMYB2 proteins activate transcription of the rd22 promoter fused to the β-glucuronidase reporter gene. This results indicate that the ATMYB2 (MYB) proteins function as transcriptional activators in the dehydration- and ABA-inducible expression of the rd22 gene4.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0641300

Description

Myb, DNA-binding domain containing protein

Version

NM_001054086.2 GI:297599665 GeneID:4330115

Length

3123 bp

Definition

Oryza sativa Japonica Group Os02g0641300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:26646702..26649824

Sequence Coding Region

26647442..26647470,26648827..26649514

Expression

GEO Profiles:Os02g0641300

Genome Context

<gbrowseImage1> name=NC_008395:26646702..26649824 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:26646702..26649824 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>gcttttctaactagcaactcccccgacgagtggtctaggatagcacggcatctacctgggagaacagacaacgaggtgaagaactactggaattcttacctgaagaagcgagtggagagcggcggcggcaagacgagccaagggccaccaaccacgcctgcgtcagccgcgagctctcccgccgattcagacgactcgcacagcctgcagcagaagccgcacgagccggccaactccgactcgtcggagccggcgcacgagtcgtcgtcggcgtcggccgactcgagctgcctgacggtgaccacggaccacccgcccgtctcgaggccccacgcggcagtgacacccaaggtcatgttcgcggactggctcgacatggagtacatctgtgggcaggtcgcggcagcacctggtctggacgctgccggattcgcggtggttggtggtgctgcaggcgatcagcagcagcagcagcagcaggtgatgagccaggacggatcggttcatcaggccgatgggccatcgtgcggcgtggacgattcttccctgcagcagcagcagcaggaggggttcggtggcaacggcggctgctgggattttcaggagcagttcgacagcatcgaccagatgcaggcgagcggcggcggcggcggcttctgcgacctgctctccatgagcgacttcgacctctgggccgagctggaacgtaccgcgtga</cdnaseq>

Protein Sequence

<aaseq>AFLTSNSPDEWSRIARHLPGRTDNEVKNYWNSYLKKRVESGGGK TSQGPPTTPASAASSPADSDDSHSLQQKPHEPANSDSSEPAHESSSASADSSCLTVTT DHPPVSRPHAAVTPKVMFADWLDMEYICGQVAAAPGLDAAGFAVVGGAAGDQQQQQQQ VMSQDGSVHQADGPSCGVDDSSLQQQQQEGFGGNGGCWDFQEQFDSIDQMQASGGGGG FCDLLSMSDFDLWAELERTA</aaseq>

Gene Sequence

<dnaseqindica>741..769#2126..2813#gttgaaacggcacaaagctccatccgttctgaaggctttgtggccgagttctcctcccccacctcctcctcctcctcctcctctgtagccgagctgaggccaacgcgagtagtgacattctcctgcaatggggtgcaagtcgtgcgagaagcccaggccgaactaccggaagggcctgtggtcaccggaggaggaccagaagctccgcgactacattctccgccatggccacggctgctggagcgcgctccctgcgaatgccggtaagaccaatcgccgcccgccgatgccgccgacgcgtaattcactacccctgccggccgccgcatgcagcatttgcgctccccaagcataattcgcgagctctaggcgcattgcaccgacaattatgcaccgaggcacacacacaaaatcggtgaattcgcgtagcctggttgcatgcggttctctttgctgaatttctcttgccgacccgtctgaattatgaaccaaaccgttctctgaacaaacaagactctgtttcttagccaattcgtgattaaatgtgcattgtgtgttgctgcttgagagctggtctcacaagaatttgtccggcgatcggtgcagggctccagaggaacgggaagagctgccggctgcggtggatcaactacctgcggccggggctgaagcacggcgtgttctcgccggaggaggaggagacggtgatgagcctccacgccgcgctcggcaacaagtaagcttttctaactagcaactcccccgacgagtctcgtcccagtcgggtccgtgcccagtccccacacacctcaccggcagcgcgcactcgatcgttcgcctttacacgcaaaatgattgagcccggagacaattctccacgttgtgcttgctagctgctgctgctgatgctgccttttcctttttcagtttagtactaatctctctctccacacttaattaagctacctagtgtagtactagtactactactactagactagactattagtaccaacgcaacagcggcactaatctttttcgtgagaaagctagttactctagctgatttgtcccagtccgggcgcgctagtgccgagctggcaattcgggttctagaacgcgctgattgacagattgtgagtgacagagtgagtgaaaggagaggaggagcggagcggaggagcggagaaatcaaaatatgaaatggtggaaagggagaattaaccggggtgatgctggctggccgccaccgcgaccttttccgtagtggagctgatgctgacgcgcacacgctccaagaacgctcctgcgcattcgaaaaccgcgagatttttcggtgcacgttgcgatgatggctagagaaaccgttgtgtgttttttttttcccctttcttcctttcgcgctagtacatttgtttattgtaaagtgcgggccactctggctgagcatgagcaacaaggacaagttgaggggggacggctaggataatgtggacttgcaacgctaaatgccacacagtacagttgcgtgcgtcccagaacaagttagctcgaattaattttttttttggggggggtctatttcttcgatttttctatcttttttgtacaggaaaaacggacactattcattttagttgtacagcgacgacgataacatgtcgtcgactggttggaccaatccgttctcagttgcgagttaatgaaaacagctgccttcacaatgcgaaactgtcacgtaggagtactagtctcgcgagaagattagattctttattgggcgtcgcaattatgtgcttccttacaaaaataaaatatcaaaggattagtggtccacatgaatagactacgtacacgcttgtccctttcaccccacaagtgacacattacatttctttaagctggtgacagaggaaaaggaaacgagaaattggaaagaaacctcaacttgtcaatgcaaaagctttgggttttccactaacccccaccgacagaaaccaagattagtgaattttaagctgtggcatactactaaccgtaaggcagagagagactgatcgatagatcattccaaaaggataaaaataacctgacttaatcactgacagcaatttttctactgcaggtggtctaggatagcacggcatctacctgggagaacagacaacgaggtgaagaactactggaattcttacctgaagaagcgagtggagagcggcggcggcaagacgagccaagggccaccaaccacgcctgcgtcagccgcgagctctcccgccgattcagacgactcgcacagcctgcagcagaagccgcacgagccggccaactccgactcgtcggagccggcgcacgagtcgtcgtcggcgtcggccgactcgagctgcctgacggtgaccacggaccacccgcccgtctcgaggccccacgcggcagtgacacccaaggtcatgttcgcggactggctcgacatggagtacatctgtgggcaggtcgcggcagcacctggtctggacgctgccggattcgcggtggttggtggtgctgcaggcgatcagcagcagcagcagcagcaggtgatgagccaggacggatcggttcatcaggccgatgggccatcgtgcggcgtggacgattcttccctgcagcagcagcagcaggaggggttcggtggcaacggcggctgctgggattttcaggagcagttcgacagcatcgaccagatgcaggcgagcggcggcggcggcggcttctgcgacctgctctccatgagcgacttcgacctctgggccgagctggaacgtaccgcgtgatgggggaacgacgtgctcaaggatcgatttttaattagagcttgttaattcatagatgtcccgtggaaatcaaattaaggggtgtttgtaatactactgcattgtaaattatcgcggtgtatttatagagctgtttaaattagcaacatatataaggaagatcagaggcatgataagtcacttctgtacgaatttatgtttgccactttgctttggagagcatgggcaccgacagaaagatggaaaggaagaaggaaagctgtagagaattgcgcctatggatgcaattattttggtttgtttattgttg</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0641300, RefSeq:Os02g0641300