Difference between revisions of "Os05g0186300"

From RiceWiki
Jump to: navigation, search
(Expression)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
NADP-ME3 was overexpressed in Arabidopsis plants to observe the changes of phenotypes, and it was found that NADP-ME3 could improve plant resistance to abiotic  stresses to a certain extent.
+
OsNADP-ME3 is a malic enzyme, and malic enzymes widely exist in plant.Malic enzyme is a key enzyme in the KERBS CYCLE. This is very important to the metabolism of organisms.In plants, it takes part in photosynthesis,respiration,production of lipids and other important metabolic pathways,which is very important to keep the osmotic potential of plant cells, stabilize the PH of cytoplasm and keep the ions absorption of plant roots balanced.It is one fo the most important enzymes in life activities of plants.[2][3]NADP-ME3 was overexpressed in Arabidopsis plants to observe the changes of phenotypes, and it was found that NADP-ME3 could improve plant resistance to abiotic  stresses to a certain extent.
  
 
===Expression===
 
===Expression===

Revision as of 03:32, 2 June 2014

Os05g0186300, namely OsNADP-ME3, is one of the cytoplasmic NADP-MEs of Rice NADP-MEs, and could improve plant resistance to abiotic stresses to a certain extent.[1]

Annotated Information

Function

OsNADP-ME3 is a malic enzyme, and malic enzymes widely exist in plant.Malic enzyme is a key enzyme in the KERBS CYCLE. This is very important to the metabolism of organisms.In plants, it takes part in photosynthesis,respiration,production of lipids and other important metabolic pathways,which is very important to keep the osmotic potential of plant cells, stabilize the PH of cytoplasm and keep the ions absorption of plant roots balanced.It is one fo the most important enzymes in life activities of plants.[2][3]NADP-ME3 was overexpressed in Arabidopsis plants to observe the changes of phenotypes, and it was found that NADP-ME3 could improve plant resistance to abiotic stresses to a certain extent.

Expression

The expressions of NADP-ME3 mRNA under a variety of abiotic stresses were detected with Northern blot.The results indicated at the exposure to NaCl, NaHCO3 and PEG, the expression level of NADP-ME3 changed withthe different lengths of exposure duration. Therefore, the NADP-ME3 may be involved in response to abioticstresses.

Evolution

Rice NADP-MEs are a multigene family of three cytoplasmic NADP-MEs and one plastidic NADP-ME. NADP-ME3 is of one of the cytoplasmic members . The cDNA sequence of the cloned NADP-ME3 is 2 240 bp, and the 5' untranslated region (UTR) is 151 bp while the 3' UTR is 376 bp. The open reading frame is 1 712 bp, encoding 570 amino acids.

Labs working on this gene

Key Laboratory of Ministry of Education for Saline-alkali Vegetation Ecology Restoration in Oil Field (SAVER), Alkali Soil Natural Environmental Science Center (ASNESC), Northeast Forestry University

Asian Natural Environmental Science Center (ANESC), University of Tokyo

References

[1]Li Xiufeng,Zhang Xinxin,Takano Tetsuo,Liu Shenkui:Expression Characteristics of Rice (Oryza sativa L.) Malic Enzyme (OsNA-DP-ME3) Gene under Environmental Stress. Genomics and Applied Biology, 2012.

Structured Information

Gene Name

Os05g0186300

Description

Similar to NADP-malic enzyme

Version

NM_001061367.1 GI:115462464 GeneID:4338007

Length

3860 bp

Definition

Oryza sativa Japonica Group Os05g0186300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:5275613..5279472

Sequence Coding Region

5275989..5276372,5276437..5276514,5276605..5276847,5276957..5277103,5277222..5277305
,5277411..5277482,5277595..5277690,5277787..5277852,5277979..5278084
,5278191..5278342,5278680..5278875,5279233..5279321

Expression

GEO Profiles:Os05g0186300

Genome Context

<gbrowseImage1> name=NC_008398:5275613..5279472 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:5275613..5279472 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccggcggcggcgtggaggacacgtacggcgaggacagggccaccgaggatcagctcatcaccccatggtccttctccgtcgccagcgggtacacgctgctgagagacccgcggcacaacaagggtttggccttctcggaggcggagcgcgacgcgcactacctccgcggcctcctcccgccatccatcgtctcgcaggagctccaggagaagaagctcatgcacaacctccgcaactacaccgtccccctccagcgctacatcgccatgatggacctccaggagaggaatgagaggctgttctacaagctcctgatcgacaacgtggaggagctgctgccggtggtgtacacgccgacggtcggggaggcctgccagaagtacggcagcatctacaggcggccacagggcctgtacatcagcctcaaggacaaggggaagatccttgaggtgctcaagaactggccggagaggagcatccaggtgatcgtcgtcaccgacggcgagcgcattcttggccttggagatcttggttgtcagggaatgggtattcctgtcggcaaactgtctctgtacactgcccttggaggagttcgcccatcagcttgccttccaatcacaattgatgttggtaccaacaatgagtcactgctcaacgacgaattctacattggactcaagcaacgccgtgctaccggagaggaataccacgagcttcttgaggagtttatgaccgcagttaagcaaaactacggcgagaaagtgctcgttcagtttgaagactttgccaaccacaatgcttttgacttgcttgcaaagtacagcaagagccaccttgtcttcaacgacgacattcagggaacagcatcagtggtcctcgcaggtctgattgcggcgctcaaggtggtcggtggaactcttgcagatcacacttacctgttccttggcgccggtgaggctggaactggcatcgcagagctcattgccctcgagatgtcaaagcagacggagattccgatcaatgattgccggaagaaggtgtggctggtggactcgagggggctgatcgtggagtcgaggaaggagtcgctgcagcacttcaagcagccattcgcgcacgagcacgagccggtgaagacgctgctggaggccgtgcagtccatcaagccgaccgtgctcatcggcacttccggcgtcggcaagacattcacccaggaggtcgtcgaggccatggccgccttcaacgagaaacctgtcatcttcgcgctctccaacccgacgtcgcactcggaatgcaccgcggaggaggcatacacctggaccaagggaagtgcggtgttcgcgagcgggagcccgttcgacgcggtggagtacgaggggaagacgtacgtgccggggcaatcgaacaacgcctacatcttcccggggttcgggctgggcgtggtgatctcgggcgccatccgcgtccacgacgacatgctgctggcggcgtcggaggcgctggcggagcaggtgagcgaggacaacttcgccagggggctcatcttcccgcccttcaccaacatccgcaagatctccgcacacatcgccgccaaggtcgccgccaaggcgtacgagctcggcctcgccagccgcctcccgcgccccgacgacctcgtcaagtacgccgagagctgcatgtacaccccggcctaccgctgctaccgctga</cdnaseq>

Protein Sequence

<aaseq>MAGGGVEDTYGEDRATEDQLITPWSFSVASGYTLLRDPRHNKGL AFSEAERDAHYLRGLLPPSIVSQELQEKKLMHNLRNYTVPLQRYIAMMDLQERNERLF YKLLIDNVEELLPVVYTPTVGEACQKYGSIYRRPQGLYISLKDKGKILEVLKNWPERS IQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGVRPSACLPITIDVGTNNESL LNDEFYIGLKQRRATGEEYHELLEEFMTAVKQNYGEKVLVQFEDFANHNAFDLLAKYS KSHLVFNDDIQGTASVVLAGLIAALKVVGGTLADHTYLFLGAGEAGTGIAELIALEMS KQTEIPINDCRKKVWLVDSRGLIVESRKESLQHFKQPFAHEHEPVKTLLEAVQSIKPT VLIGTSGVGKTFTQEVVEAMAAFNEKPVIFALSNPTSHSECTAEEAYTWTKGSAVFAS GSPFDAVEYEGKTYVPGQSNNAYIFPGFGLGVVISGAIRVHDDMLLAASEALAEQVSE DNFARGLIFPPFTNIRKISAHIAAKVAAKAYELGLASRLPRPDDLVKYAESCMYTPAY RCYR</aaseq>

Gene Sequence

<dnaseqindica>3101..3484#2959..3036#2626..2868#2370..2516#2168..2251#1991..2062#1783..1878#1621..1686#1389..1494#1131..1282#598..793#152..240#atcccatccacgcaaatatttcttcctataacaggacaagagcagatcgatcgtttcctttttatttctgaggagaagaggatcgatcgtttcgttcgatcgtttggtttttgaattttgaggagaagagaagagaagaggatcggaagagatggccggcggcggcgtggaggacacgtacggcgaggacagggccaccgaggatcagctcatcaccccatggtccttctccgtcgccaggttagagacatcatctccttcgagttcgtcttcttcttcgaattcggcatccatcaatcccttgttctatctcaagcctctgctttttatttccttccgtttttgttcccaactttctctacacccaccataaagtttccgtttgttttactccgccggtttcctgactcgcttcagttacaagcttgtccggcctaaaaaaaaactgattcgtgtcgttcattgcatcaaatccatgaaaatctacattaatttgagaattgagtctttccgaatcgcaaccgatcgttcggtggccataacaaaaaatttgaatttgaattcgaatttcttgcgctgtgatgtgatgtgatgcagcgggtacacgctgctgagagacccgcggcacaacaagggtttggccttctcggaggcggagcgcgacgcgcactacctccgcggcctcctcccgccatccatcgtctcgcaggagctccaggagaagaagctcatgcacaacctccgcaactacaccgtccccctccagcgctacatcgccatgatggacctccaggtacaatcacaaacaccaccaccaccaccaccaaaagtttgatcacccactcaaatcaaatgcattgataatgttcatgcagcaagaactgtggattacttctttttttttttttgagaagggtatttttactcgagctctacattcaatcggatacatgcagcctttttaaattagaaacttagcttaccaaacagagaacttagcccttagataacccaacatgaaatttgttcctatggagatttgaactcaacacctacatgccctttcactagaactgtggattactgaacactgtcatgtttcttggtttttttgtgcttttctttttcaggagaggaatgagaggctgttctacaagctcctgatcgacaacgtggaggagctgctgccggtggtgtacacgccgacggtcggggaggcctgccagaagtacggcagcatctacaggcggccacagggcctgtacatcagcctcaaggacaagtgcggtttttgttgctaggattctgctttccttctgatgatggtgaggttgattaggaatttgcagcctgacaggaatctgtgtttgtttgtttggtggattcagggggaagatccttgaggtgctcaagaactggccggagaggagcatccaggtgatcgtcgtcaccgacggcgagcgcattcttggccttggagatcttggttgtcaggtagtgcatttttcccccatttcctgccctgattttgctgtcatgaatgtgtcgaaagaatttagatgtgatgatgtatgtttacctggaagcatttgctgatatgtgctgctgttactatgtcagggaatgggtattcctgtcggcaaactgtctctgtacactgcccttggaggagttcgcccatcagctgtgagtgttcttgtcttcatgaaatgatcaaagtatttttagtctgttgatggatttgctttgctgactataaatgtgaatatatgtatgatgcagtgccttccaatcacaattgatgttggtaccaacaatgagtcactgctcaacgacgaattctacattggactcaagcaacgccgtgctaccggagaggtaagccacagtttctgcacacgtagttcacctgcaattaattggtgaaacagaaaactctttttaccatagaatttcttttttatcttatctctgttatcatggttatcaggaataccacgagcttcttgaggagtttatgaccgcagttaagcaaaactacggcgagaaagtgctcgttcaggtcagtctgcatagaagaattaattaagttacatgtgcacactctgtttttacctttatcaggattcaggagatgactgaataacatcaaatttcctttccacagtttgaagactttgccaaccacaatgcttttgacttgcttgcaaagtacagcaagagccaccttgtcttcaacgacgacattcaggtacaagaaagcgaaacttttgtgaacctcttctggtttcacgcccatataatttgtctgaatcagtagccacaaaaatactaatgtgatgaatttggtctacaacgatggatggcagggaacagcatcagtggtcctcgcaggtctgattgcggcgctcaaggtggtcggtggaactcttgcagatcacacttacctgttccttggcgccggtgaggctggaactggcatcgcagagctcattgccctcgagatgtcaaagcaggtaactgaatgaaaacacactgcaaactctgaatattgcctcactcactttcactgaatatgataaacaacaatatggagtgtgatttgattgtgtgttattcgtgtagacggagattccgatcaatgattgccggaagaaggtgtggctggtggactcgagggggctgatcgtggagtcgaggaaggagtcgctgcagcacttcaagcagccattcgcgcacgagcacgagccggtgaagacgctgctggaggccgtgcagtccatcaagccgaccgtgctcatcggcacttccggcgtcggcaagacattcacccaggaggtcgtcgaggccatggccgccttcaacgaggtaaccaatgcacacatcatggtggctgcatatgtgcgctcctcttcttgatgatgatgatcaagtgcactaacatgaaatcaaatgcagaaacctgtcatcttcgcgctctccaacccgacgtcgcactcggaatgcaccgcggaggaggcatacacctggaccaaggtgagagatcaatagagctgaatcgaaatcgtcaatggcgatctgaatcgaaatgtttgtgcagggaagtgcggtgttcgcgagcgggagcccgttcgacgcggtggagtacgaggggaagacgtacgtgccggggcaatcgaacaacgcctacatcttcccggggttcgggctgggcgtggtgatctcgggcgccatccgcgtccacgacgacatgctgctggcggcgtcggaggcgctggcggagcaggtgagcgaggacaacttcgccagggggctcatcttcccgcccttcaccaacatccgcaagatctccgcacacatcgccgccaaggtcgccgccaaggcgtacgagctcggcctcgccagccgcctcccgcgccccgacgacctcgtcaagtacgccgagagctgcatgtacaccccggcctaccgctgctaccgctgatcgagcacgagcccaccgaggaggaagacgatcgatcgaattaagcaataaaatttttattcaaatcttggcgcgagcgttagctgccattagaggggttttcatttttaattttttttgtgtacccatacatatacgtatacgtgtactgcatacatactagagcacctgatggtgcttgtcgtcgtcgattcttttgaccgatttgaagtttggtagggtgtaatagcacttacttttgagttttccacattgagttgattcggtgtaataggagtcaaatttgagtttcttatgatggttgttcatgatcagtttctgatgcaatgcgtcgtgtcatttttacccaataaaagcagagatgcttacttagtgg</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0186300, RefSeq:Os05g0186300