Difference between revisions of "Os12g0472500"
(→Function) |
(→Annotated Information) |
||
| Line 10: | Line 10: | ||
* OsTDL1A has another name is MIL2. MIL2 is responsible for the differentiation of primary parietal cells into secondary parietal cells in rice anthers. | * OsTDL1A has another name is MIL2. MIL2 is responsible for the differentiation of primary parietal cells into secondary parietal cells in rice anthers. | ||
| − | === | + | === Mutatio and Expression=== |
Rice contains two close homologues of TPD1 (OsTDL1A and OsTDL1B). The sites of expression of these genes relative to MSP1, examine the affinity of OsTDL1A and OsTDL1B proteins for the LRR domain of MSP1, and study the effect of RNA interference of OsTDL1A on anther and ovule. MSP1 and its close paralog MSP1-like1 (MSL1) are structurally the most similar rice proteins to EXS/EMS1. | Rice contains two close homologues of TPD1 (OsTDL1A and OsTDL1B). The sites of expression of these genes relative to MSP1, examine the affinity of OsTDL1A and OsTDL1B proteins for the LRR domain of MSP1, and study the effect of RNA interference of OsTDL1A on anther and ovule. MSP1 and its close paralog MSP1-like1 (MSL1) are structurally the most similar rice proteins to EXS/EMS1. | ||
| Line 18: | Line 18: | ||
The full-length protein sequence of Arabidopsis TPD1 [AAR25553, 176 amino acids (aa)] was used as the query in a tblastn search of the rice genome. We detected two TPD1-like genes and named them OsTDL1A (blaste-value: 5 × 10−27) and OsTDL1B (blaste-value: 1 × 10−18). They are located on chromosomes 12 and 10, respectively, and the corresponding full-length cDNAs are AK108523 and AK121594. When their predicted protein sequences (NP_001066753, 226 aa; NP_001064316, 169 aa) were used as tblastn queries of the Arabidopsis genome, the best hits were to TPD1 and another Arabidopsis protein (ABF59206, 179 aa), which we have named AtTDL1. TPD1 is more similar to AtTDL1 (e-value: 2 × 10−35) than OsTDL1A is to OsTDL1B (e-value: 2 × 10−14), a conclusion supported by CLUSTALW analysis (Figure 1A). The four proteins cluster separately from the next most similar proteins encoded by the rice and Arabidopsis genomes (the boxed proteins are from rice). | The full-length protein sequence of Arabidopsis TPD1 [AAR25553, 176 amino acids (aa)] was used as the query in a tblastn search of the rice genome. We detected two TPD1-like genes and named them OsTDL1A (blaste-value: 5 × 10−27) and OsTDL1B (blaste-value: 1 × 10−18). They are located on chromosomes 12 and 10, respectively, and the corresponding full-length cDNAs are AK108523 and AK121594. When their predicted protein sequences (NP_001066753, 226 aa; NP_001064316, 169 aa) were used as tblastn queries of the Arabidopsis genome, the best hits were to TPD1 and another Arabidopsis protein (ABF59206, 179 aa), which we have named AtTDL1. TPD1 is more similar to AtTDL1 (e-value: 2 × 10−35) than OsTDL1A is to OsTDL1B (e-value: 2 × 10−14), a conclusion supported by CLUSTALW analysis (Figure 1A). The four proteins cluster separately from the next most similar proteins encoded by the rice and Arabidopsis genomes (the boxed proteins are from rice). | ||
Single amplicons of the expected size for OsTDL1A and OsTDL1B (546 and 485 bp, respectively) were generated from RNA of roots and spikelets (1 mm, 3 mm and 5 DAF). Three amplicon sizes were seen for MSP1, as was also reported by Nonomura et al. (2003). The sizes of these amplicons are consistent with the sizes expected for the fully spliced transcript (507 bp), a transcript in which only the first intron has been removed by splicing (752 bp) and an unspliced transcript (1298 bp), based on the full-length cDNA sequence (AK120933). The smallest amplicon was amplified most strongly from 1- and 3-mm spikelets. The largest amplicon was not a PCR product derived from possible DNA contamination, because the RNA preparations lacked DNA contamination as judged by the failure of the GAPDH primers to produce the genomic amplicon (Figure 2, open arrow). We conclude that MSP1, OsTDL1A and OsTDL1B are all expressed in spikelets before and during meiosis. | Single amplicons of the expected size for OsTDL1A and OsTDL1B (546 and 485 bp, respectively) were generated from RNA of roots and spikelets (1 mm, 3 mm and 5 DAF). Three amplicon sizes were seen for MSP1, as was also reported by Nonomura et al. (2003). The sizes of these amplicons are consistent with the sizes expected for the fully spliced transcript (507 bp), a transcript in which only the first intron has been removed by splicing (752 bp) and an unspliced transcript (1298 bp), based on the full-length cDNA sequence (AK120933). The smallest amplicon was amplified most strongly from 1- and 3-mm spikelets. The largest amplicon was not a PCR product derived from possible DNA contamination, because the RNA preparations lacked DNA contamination as judged by the failure of the GAPDH primers to produce the genomic amplicon (Figure 2, open arrow). We conclude that MSP1, OsTDL1A and OsTDL1B are all expressed in spikelets before and during meiosis. | ||
| + | |||
== Headline text == | == Headline text == | ||
{{JaponicaGene| | {{JaponicaGene| | ||
Revision as of 04:48, 2 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
- OsTDL1A, the closest rice homolog of the Arabidopsis (TAPETUM DETERMINANT1)TPD1 gene. In Arabidopsis TPD1, which encodes a small protein hypothesized to be an extracellular ligand of EXS/EMS1.
- OsTDL1A binds to the LRR domain of rice receptor kinase (MULTIPLE SPOROCYTES1)MSP1, and is required to limit sporocyte numbers. MSP1 encodes a leucine-rich-repeat receptor kinase, which is orthologous to EXS/EMS1 in Arabidopsis. Like mac1 and msp1, exs/ems1 mutants produce extra sporocytes in the anther instead of a tapetum, causing male sterility. OsTDL1A binds MSP1 in order to limit sporocyte numbers. OsTDL1A-RNAi lines may be suitable starting points for achieving synthetic apospory in rice.
- OsTDL1A has another name is MIL2. MIL2 is responsible for the differentiation of primary parietal cells into secondary parietal cells in rice anthers.
Mutatio and Expression
Rice contains two close homologues of TPD1 (OsTDL1A and OsTDL1B). The sites of expression of these genes relative to MSP1, examine the affinity of OsTDL1A and OsTDL1B proteins for the LRR domain of MSP1, and study the effect of RNA interference of OsTDL1A on anther and ovule. MSP1 and its close paralog MSP1-like1 (MSL1) are structurally the most similar rice proteins to EXS/EMS1.
Evolution
OsTDL1A and OsTDL1B are rice homologs of TPD1 of Arabidopsis
The full-length protein sequence of Arabidopsis TPD1 [AAR25553, 176 amino acids (aa)] was used as the query in a tblastn search of the rice genome. We detected two TPD1-like genes and named them OsTDL1A (blaste-value: 5 × 10−27) and OsTDL1B (blaste-value: 1 × 10−18). They are located on chromosomes 12 and 10, respectively, and the corresponding full-length cDNAs are AK108523 and AK121594. When their predicted protein sequences (NP_001066753, 226 aa; NP_001064316, 169 aa) were used as tblastn queries of the Arabidopsis genome, the best hits were to TPD1 and another Arabidopsis protein (ABF59206, 179 aa), which we have named AtTDL1. TPD1 is more similar to AtTDL1 (e-value: 2 × 10−35) than OsTDL1A is to OsTDL1B (e-value: 2 × 10−14), a conclusion supported by CLUSTALW analysis (Figure 1A). The four proteins cluster separately from the next most similar proteins encoded by the rice and Arabidopsis genomes (the boxed proteins are from rice).
Single amplicons of the expected size for OsTDL1A and OsTDL1B (546 and 485 bp, respectively) were generated from RNA of roots and spikelets (1 mm, 3 mm and 5 DAF). Three amplicon sizes were seen for MSP1, as was also reported by Nonomura et al. (2003). The sizes of these amplicons are consistent with the sizes expected for the fully spliced transcript (507 bp), a transcript in which only the first intron has been removed by splicing (752 bp) and an unspliced transcript (1298 bp), based on the full-length cDNA sequence (AK120933). The smallest amplicon was amplified most strongly from 1- and 3-mm spikelets. The largest amplicon was not a PCR product derived from possible DNA contamination, because the RNA preparations lacked DNA contamination as judged by the failure of the GAPDH primers to produce the genomic amplicon (Figure 2, open arrow). We conclude that MSP1, OsTDL1A and OsTDL1B are all expressed in spikelets before and during meiosis.
Headline text
| Gene Name |
Os12g0472500 |
|---|---|
| Description |
Glutelin family protein |
| Version |
NM_001073285.1 GI:115488531 GeneID:4352199 |
| Length |
2453 bp |
| Definition |
Oryza sativa Japonica Group Os12g0472500, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 12:17133143..17135595 |
| Sequence Coding Region |
17133694..17133826,17134519..17134635,17134998..17135428 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008405:17133143..17135595 source=RiceChromosome12 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008405:17133143..17135595 source=RiceChromosome12 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgagggtctcctcggcgtccagtacgccgccgccgccggcgttcgcggccgcggcgtgggcggtggtgctgctcgccatgctccgctccgacgtcgccctcgccgccgccgcatcctccaacgacgacacaggtctctcgccgttgatgccgccgccgccgctcgccgccccggttcccgcggcggtttctccggccccggcgacgcctcccgccgtcctctccccccgcaagctcctccgcccgcaaggcgcggacgtcgtcggcgtcggtttcgtctccggcagcggcggcggaggaggaggagacggagtacggacgcgccgggtggacgacgggtgcgcgggggcggacgacatcgcgatctaccaggggagggcgacgccgctgccgagcggggtgccggcgtacacggtggacgtgatgaaccggtgcgccggcggcggcggcggcgacgaggagtgcgccatcgcggggatccacgtgcggtgcgggtggttcagctcggtgagcctggtggacccgcgcgtgttccgccggctcggccacgacgactgcctcctcaacgacggccgcccgctcctcgccggcgagaccgtctccttcgagtacaccaactccttcccctacaagctctccgtctccgtcgcaacctgcgtcgtcgaccccgccgccccatag</cdnaseq> |
| Protein Sequence |
<aaseq>MRVSSASSTPPPPAFAAAAWAVVLLAMLRSDVALAAAASSNDDT GLSPLMPPPPLAAPVPAAVSPAPATPPAVLSPRKLLRPQGADVVGVGFVSGSGGGGGG DGVRTRRVDDGCAGADDIAIYQGRATPLPSGVPAYTVDVMNRCAGGGGGDEECAIAGI HVRCGWFSSVSLVDPRVFRRLGHDDCLLNDGRPLLAGETVSFEYTNSFPYKLSVSVAT CVVDPAAP</aaseq> |
| Gene Sequence |
<dnaseqindica>552..684#1377..1493#1856..2286#cttttcgtttcgtttcgccgcccgcttccgccgcgcgcgcgcacgtgcgagaggggagagggggatagcgacgccgcgcccaaaccctactactactcctcctcctcctccgcgtcctcgccggccactcgtcgccggcctccgtcgccgcctccgcctcgtcatccaccagaaggtaggcgccgacctcctcctcctctttctccttctcgagcctacgcgggcgagggttccgaggtgtgcgagtgtggtctcgtctccctcccggagacgcgtgctccggtgggtgggagggatggtgtccgcgtcggtttgggcggaggcggaggagcgggggaagggggcgcgtggcccgaggcggcgccgctgcgtgtcctctctctcgcaagctttctgcgggcctttttggtttctccgccgatgctctagttcgtcgcatccttttctgtgtagtattttcgttgcagatggagccatggaggtggcagatctgtctcgtgaccccccggagttttttgtttcaggcgttcgtgcgcacgggtttccgcgcgatgagggtctcctcggcgtccagtacgccgccgccgccggcgttcgcggccgcggcgtgggcggtggtgctgctcgccatgctccgctccgacgtcgccctcgccgccgccgcatcctccaacgacgacacaggtgacgcaccattccaaaaccaccccgcttcatcctgtgcgctgctgcttgattctcccacacatgattcgccagttttttttgtctgcacatatatttctgaaaaaaaaatcgcactcctttcctcgtcaaatctctctgcgttttggctccgtttcgatgagatcattctccctaaaaatttttgtatgaataaaattctcgaaataccgcacgggtgcaatggatttgcaccattagttttgcatcactaggagcatcattaataattacggacgagatctctctctctctccctccatccgtgcggtttctggaatttgcattgtactgctactgttcatcgtgttcatgcctccacgtcgacctgcgccttcctttccaagattgggatacgaacaaggagaggcgcagcgcggtgggcccaccaccaacccacccacccccacccatccatccattcccatggattcgaaatgttttttttttggttggttggttgatttcgctctgttcgtatcgctgttctcccactgtgtgctactgccgccgccgcgtcgtggatttgtcgcgtggggtgaagtttttgggcttttgtgtgtcgctgacggggtggggcccactccgggttggtcccacgtgtctgtcgccgtgtggcgggggtctaatcgtgcgggcgtttttttgtgcaggtctctcgccgttgatgccgccgccgccgctcgccgccccggttcccgcggcggtttctccggccccggcgacgcctcccgccgtcctctccccccgcaagctcctccgcccgcaaggtaaaagcaagcttcctatccccgattccctcggcgatgcttatctcgccgtccgattgaccgatcggacggctgctgcttggcccacgcggccggcgctttctccgacaagcctctgacgcaggccgtgggggccagaggggggggagcctgatatgtggggtccacggagacgcctcctgttttgtcctcggagacgagacgatccctttggcgcgccatgattccgtcgccctcacattccattctgtcgtatcggagcatgacatgtgggcccgtgtctgcggtgctctcagtttttcgtcgccgcatgcatgcagtgactgaccggtggggcccgcttgctttcaccctttttgcaggcgcggacgtcgtcggcgtcggtttcgtctccggcagcggcggcggaggaggaggagacggagtacggacgcgccgggtggacgacgggtgcgcgggggcggacgacatcgcgatctaccaggggagggcgacgccgctgccgagcggggtgccggcgtacacggtggacgtgatgaaccggtgcgccggcggcggcggcggcgacgaggagtgcgccatcgcggggatccacgtgcggtgcgggtggttcagctcggtgagcctggtggacccgcgcgtgttccgccggctcggccacgacgactgcctcctcaacgacggccgcccgctcctcgccggcgagaccgtctccttcgagtacaccaactccttcccctacaagctctccgtctccgtcgcaacctgcgtcgtcgaccccgccgccccatagccgccgtcaatcgccgcaaggaaaaagtagacaaaacaaaagaaacgaaagagaaacagtagtactagtgacatctcttgccttactagtttttttgttcttttctttttttttgaccccatgtcagtatcactcacagaacaacagctcaccatttgctacgcctc</dnaseqindica> |
| External Link(s) |
