Difference between revisions of "Os05g0128400"
(→Evolution) |
(→Structured Information) |
||
| Line 52: | Line 52: | ||
==Structured Information== | ==Structured Information== | ||
| + | *'''Sequence analysis of OsMTP1''' | ||
| + | The full-length cDNA fragment of OsMTP1 (accession no. | ||
| + | AY266290 /LOC_Os05g03780) was amplified by high-fidelity | ||
| + | RT–PCR based on GenBank™ and the Rice Annotation | ||
| + | Project information from NCBI (http://www.ncbi.nlm.nih. | ||
| + | gov/nuccore). It encodes a protein with 418 amino acids. | ||
| + | Percentage identities and similarities between OsMTP1, | ||
| + | AtMTP1, and HvMTP1 are shown in '''Table 1'''. The highest | ||
| + | identity (85%) and similarity (90%) scores at the amino acid | ||
| + | level were observed between OsMTP1 and HvMTP1. MTP | ||
| + | amino acid sequences were searched for in the genomes of | ||
| + | six monocotyledons, Sorghum bicolor, Zea mays, Setaria | ||
| + | italica, Hordeum vulgare, O. sativa, and Brachypodium | ||
| + | distachyon, and a phylogenetic tree including A. thaliana | ||
| + | MTP1 and MTP3 sequences was generated ('''Fig.1'''). In the | ||
| + | search, it is clear that O. sativa has only one MTP1 sequence, | ||
| + | while Z. mays and B. distachyon have two, indicating that the | ||
| + | appearance of new MTP1 sequences occurred after the speciation | ||
| + | of each monocot. The multiple sequence alignment | ||
| + | of AtMTP1, OsMTP1, and HvMTP1 proteins is shown in | ||
| + | Fig. 2; positions with a single, fully conserved residue are | ||
| + | highlighted, as are those with conserved similar properties. | ||
| + | TMDs predicted by Phobius (http://phobius.sbc.su.se/) are | ||
| + | also marked in '''Fig. 2'''. The proteins are predicted to possess | ||
| + | cytoplasmic N- and C-termini and six TMDs, with a | ||
| + | small cytoplasmic loop between TMDs II and III, and a | ||
| + | large cytoplasmic, histidine-rich loop between TMDs IV | ||
| + | and V. OsMTP1 possesses the loop with the most histidine | ||
| + | residues, followed by HvMTP1. The 17 residues of the CDF | ||
| + | signature sequence are identical for | ||
| + | each sequence, and are highlighted in '''Fig. 2'''. | ||
{{JaponicaGene| | {{JaponicaGene| | ||
GeneName = Os05g0128400| | GeneName = Os05g0128400| | ||
Revision as of 06:43, 3 June 2014
Gene Os05g0128400,namely OsMTP1 and OZT1, is a rice metal tolerance protein and a vacuolar zinc transporter.[1][2]
Contents
Annotated Information
Function
- Rice (Oryza sativa L. ‘Nipponbare’) cDNA subtractive suppression hybridization (SSH) libraries constructed using cadmium (Cd)-treated seedling roots were screened to isolate Cd-responsive genes. A cDNA clone, encoding the rice homolog of Metal Tolerance Protein (OsMTP1), was induced by Cd treatment. Plant MTPs belong to cation diffusion facilitator (CDF) protein family, which are widespread in bacteria, fungi, plants, and animals.OsMTP1 fused to green fluorescent protein was localized in onion epidermal cell plasma membranes, consistent with an OsMTP1 function in heavy metal transporting. OsMTP1 dsRNAi mediated by transgenic assay in rice seedlings resulted in heavy metal sensitivity and changed the heavy metal accumulation in different organs of mature rice under low-concentration heavy metal stress. [1]
- Heavy metal homeostasis is maintained in plant cells by specialized transporters which compartmentalize or efflux metal ions, maintaining cytosolic concentrations within a narrow range. OsMTP1 is a member of the cation diffusion facilitator (CDF)/metal tolerance protein (MTP) family of metal cation transporters in Oryza sativa, which is closely related to Arabidopsis thaliana MTP1. Functional complementation of the Arabidopsis T-DNA insertion mutant mtp1-1 demonstrates that OsMTP1 transports Zn in planta and localizes at the tonoplast. When heterologously expressed in the yeast mutant zrc1 cot1, OsMTP1 complemented its Zn hypersensitivity and was also localized to the vacuole.OsMTP1 alleviated, to some extent, the Co sensitivity of this mutant, rescued the Fe hypersensitivity of the ccc1 mutant at low Fe concentrations, and restored growth of the Cd-hypersensitive mutant ycf1 at low Cd concentrations.These results suggest that OsMTP1 transports Zn but also Co, Fe, and Cd, possibly with lower affinity. Site-directed mutagenesis studies revealed two substitutions in OsMTP1 that alter the transport function of this protein. OsMTP1 harbouring a substitution of Leu82 to a phenylalanine can still transport low levels of Zn, with an enhanced affinity for Fe and Co, and a gain of function for Mn. A substitution of His90 with an aspartic acid completely abolishes Zn transport but improves Fe transport in OsMTP1. These amino acid residues are important in determining substrate specificity and may be a starting point for refining transporter activity in possible biotechnological applications, such as biofortification and phytoremediation.[3]
- In plants, CDFs are known as metal tolerance proteins(MTPs)[4]. MTP genes have been cloned from a number of plant species and are shown to have a role in heavy metal transport [5][6][7][8][9][10][11]. Twelve MTP genes have been classified in Arabidopsis and 10 in rice [12]. The first, identified as ZAT or Zinc Transporter of Arabidopsis [13], was renamed AtMTP1. Overexpression in Arabidopsis enhances Zn resistance[13] while T-DNA insertion [7] or RNA interference (RNAi)-mediated silencing[14] increases Zn sensitivity.The Zn hyperaccumulator plant Arabidopsis halleri had a pentaplication of the MTP1 gene during the evolutionary process,which is believed to have a role in Zn hypertolerance [15]. AtMTP3 is also thought to be involved in Zn transport [16], while AtMTP11 transports Mn (8; 9).The rice orthologue OsMTP1 was recently characterized by Yuan et al. [1] and Lan et al. [2]Located on chromosome 5, it is most highly expressed in mature leaves and stem [1]. Both overexpression and RNAimediated silencing suggest a role for the transporter in Zn,Cd, and nickel (Ni) movement, a hypothesis strengthened by functional complementation of yeast mutants [1]. However, there is controversy over OsMTP1 localization,reported at the plasma membrane when expressed in onion epidermal cells[1] or at the vacuole when expressed in Saccharomyces cerevisiae[1].This study aims to clarify the membrane localization of OsMTP1 and investigate the importance of key residues in transport ability and specificity. It is shown here that OsMTP1 is localized to the vacuole when stably expressed in planta. It is further demonstrated that OsMTP1 is a Zn transporter that can also transport cobalt (Co), Fe, and Cd. Moreover, it is shown that single residue substitutions can alter substrate specificity.
- The CDF family is a ubiquitous family that has been identified in prokaryotes, eukaryotes, and archaea. Members of this family are important heavy metal transporters that transport metal ions out of the cytoplasm. In this research, a full length cDNA named Oryza sativa Zn Transporter 1 (OZT1) that closely related to rat ZnT-2 (Zn Transporter 2) gene was isolated from rice. The OZT1 encoding a CDF family protein shares 28.2 % ~ 84.3 % of identities and 49.3 % ~ 90.9 % of similarities with other zinc transporters such as RnZnT-2, HsZnT-8, RnZnT-8 and AtMTP1.[2]
Expression
- OsMTP1 heterologous expression in yeast mutants showed that OsMTP1 was able to complement the mutant strains’ hypersensitivity to Ni, Cd, and Zn, but not other metals including Co and Mn. OsMTP1 expression increased tolerance to Zn, Cd, and Ni in wild-type yeast BY4741 during the exponential growth phase. [1]
- OZT1 was constitutively expressed in various rice tissues. The OZT1 expression was significantly induced both in the seedlings of japonica rice Nipponbare and indica rice IR26 in response to Zn2+ and Cd2+ treatments. Besides, OZT1 expression was also increased when exposed to other excess metals, such as Cu2+, Fe2+ and Mg2+. Subcellular localization analysis indicated that OZT1 localized to vacuole. Heterologous expression of OZT1 in yeast increased tolerance to Zn2+ and Cd2+ stress but not the Mg2+ stress.[2]
Evolution
- OsMTP1 is a bivalent cation transporter localized in the cell membrane, which is necessary for efficient translocation of Zn, Cd and other heavy metals, and maintain ion homeostasis in plant.[1]
- OZT1 is a CDF family vacuolar zinc transporter conferring tolerance to Zn2+ and Cd2+ stress, which is important to transporting and homeostasis of Zn, Cd or other heavy metals in plants.[2]
Labs working on this gene
- 1. Key Laboratory of Plant Resources Conservation and Sustainable Utilization, South China Botanical Garden, Chinese Academy of Sciences
- 2. Graduate School of the Chinese Academy of Sciences
- 3. State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University
- 4.Centre for Biological Science, University of Southampton, Life Sciences Building 85, Highfield Campus, Southampton SO17 1B, UK
- 5.Departamento de Botânica, Instituto de Biociências, Universidade Federal do Rio Grande do Sul, Av. Bento Gonçalves 9500, Porto
Alegre, 91501–970, Brazil
- 6.Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, Av. Bento Gonçalves 9500, PO Box 15005, Porto Alegre,
91501–970, Brazil
References
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Lianyu Yuan,Songguang Yang,Baoxiu Liu,et al.Molecular characterization of a rice metal tolerance protein, OsMTP1.Plant Cell Reports, 2012, 31(1): 67-79 .
- ↑ 2.0 2.1 2.2 2.3 2.4 Hong-Xia Lan, Zhou-Fei Wang, Qi-Hong Wang, et al.Characterization of a vacuolar zinc transporter OZT1 in rice (Oryza sativa L.).Molecular Biology Reports, 2013, 40(2): 1201-1210.
- ↑ Paloma K. Menguer, Emily Farthing, Kerry A. Peaston,et al.Functional analysis of the rice vacuolar zinc transporter OsMTP.Journal of Experimental Botany,2013,64(10):2871–2883.
- ↑ Montanini B, Blaudez D, Jeandroz S, Sanders D, Chalot M. 2007. Phylogenetic and functional analysis of the Cation Diffusion Facilitator (CDF) family: improved signature and prediction of substrate specificity. BMC Genomics 8, 107.
- ↑ Blaudez D, Kohler A, Martin F, Sanders D, Chalot M. 2003.Poplar metal tolerance protein 1 confers zinc tolerance and is an oligomeric vacuolar zinc transporter with an essential leucine zipper motif. The Plant Cell 15, 2911–2928.
- ↑ Kim D, Gustin JL, Lahner B, Persans MW, Baek D, Yun DJ, Salt DE. 2004. The plant CDF family member TgMTP1 from the Ni/Zn hyperaccumulator Thlaspi goesingense acts to enhance efflux of Zn at the plasma membrane when expressed in Saccharomyces cerevisiae. The Plant Journal 39, 237–251.
- ↑ 7.0 7.1 Kobae Y, Uemura T, Sato MH, Ohnishi M, Mimura T, Nakagawa T, Maeshima M. 2004. Zinc transporter of Arabidopsis thaliana AtMTP1 is localized to vacuolar membranes and implicated in zinc homeostasis. Plant and Cell Physiology 45, 1749–1758.
- ↑ Delhaize E, Gruber BD, Pittman JK, White RG, Leung H, Miao Y, Jiang L, Ryan PR, Richardson AE. 2007. A role for the AtMTP11 gene of Arabidopsis in manganese transport and tolerance. The Plant Journal 51, 198–210.
- ↑ Peiter E, Montanini B, Gobert A, Pedas P, Husted S, Maathuis FJ, Blaudez D, Chalot M, Sanders D. 2007. A secretory pathwaylocalized cation diffusion facilitator confers plant manganese tolerance. Proceedings of the National Academy of Sciences, USA 104,8532–8537.
- ↑ Kawachi M, Kobae Y, Kogawa S, Mimura T, Kramer U,Maeshima M. 2012. Amino acid screening based on structural modeling identifies critical residues for function, ion selectivity and structure of Arabidopsis MTP1. FEBS Journal 279, 2339–2356.
- ↑ Podar D, Scherer J, Noordally Z, Herzyk P, Nies D, Sanders D. 2012. Metal selectivity determinants in a family of transition metal transporters. Journal of Biological Chemistry 287, 3185–3196.
- ↑ Gustin JL, Zanis MJ, Salt DE. 2011. Structure and evolution of the plant cation diffusion facilitator family of ion transporters. BMC Evolutionary Biology 11, 76.
- ↑ 13.0 13.1 van der Zaal BJ, Neuteboom LW, Pinas JE, Chardonnens AN, Schat H, Verkleij JA, Hooykaas PJ. 1999. Overexpression of a novel Arabidopsis gene related to putative zinc-transporter genes from animals can lead to enhanced zinc resistance and accumulation. Plant Physiology 119, 1047–1055.
- ↑ Desbrosses-Fonrouge AG, Voigt K, Schroder A, Arrivault S, Thomine S, Kramer U. 2005. Arabidopsis thaliana MTP1 is a Zn transporter in the vacuolar membrane which mediates Zn detoxification and drives leaf Zn accumulation. FEBS Letters 579,4165–4174.
- ↑ Shahzad Z, Gosti F, Frerot H, Lacombe E, Roosens N, Saumitou-Laprade P, Berthomieu P. 2010. The five AhMTP1 zinc transporters undergo different evolutionary fates towards adaptive evolution to zinc tolerance in Arabidopsis halleri. PLoS Genetics 6, e1000911.
- ↑ Arrivault S, Senger T, Kramer U. 2006. The Arabidopsis metal tolerance protein AtMTP3 maintains metal homeostasis by mediatingZn exclusion from the shoot under Fe deficiency and Zn oversupply. The Plant Journal 46, 861–879.
Structured Information
- Sequence analysis of OsMTP1
The full-length cDNA fragment of OsMTP1 (accession no. AY266290 /LOC_Os05g03780) was amplified by high-fidelity RT–PCR based on GenBank™ and the Rice Annotation Project information from NCBI (http://www.ncbi.nlm.nih. gov/nuccore). It encodes a protein with 418 amino acids. Percentage identities and similarities between OsMTP1, AtMTP1, and HvMTP1 are shown in Table 1. The highest identity (85%) and similarity (90%) scores at the amino acid level were observed between OsMTP1 and HvMTP1. MTP amino acid sequences were searched for in the genomes of six monocotyledons, Sorghum bicolor, Zea mays, Setaria italica, Hordeum vulgare, O. sativa, and Brachypodium distachyon, and a phylogenetic tree including A. thaliana MTP1 and MTP3 sequences was generated (Fig.1). In the search, it is clear that O. sativa has only one MTP1 sequence, while Z. mays and B. distachyon have two, indicating that the appearance of new MTP1 sequences occurred after the speciation of each monocot. The multiple sequence alignment of AtMTP1, OsMTP1, and HvMTP1 proteins is shown in Fig. 2; positions with a single, fully conserved residue are highlighted, as are those with conserved similar properties. TMDs predicted by Phobius (http://phobius.sbc.su.se/) are also marked in Fig. 2. The proteins are predicted to possess cytoplasmic N- and C-termini and six TMDs, with a small cytoplasmic loop between TMDs II and III, and a large cytoplasmic, histidine-rich loop between TMDs IV and V. OsMTP1 possesses the loop with the most histidine residues, followed by HvMTP1. The 17 residues of the CDF signature sequence are identical for each sequence, and are highlighted in Fig. 2.
| Gene Name |
Os05g0128400 |
|---|---|
| Description |
Similar to Metal tolerance protein 1 (AtMTP1) (Zinc transporter ZAT-1) (ZAT1p) [Contains: Metal tolerance protein 1 short form] |
| Version |
NM_001061074.1 GI:115461878 GeneID:4337694 |
| Length |
3560 bp |
| Definition |
Oryza sativa Japonica Group Os05g0128400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 5:1653539..1657098 |
| Sequence Coding Region |
1653962..1655218 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008398:1653539..1657098 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008398:1653539..1657098 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggacagccataactcagcacctccccagattgctgaagtgagaatggacatctcatcatctacttctgtagcagctgggaacaaagtttgcagaggtgctgcttgtgacttttctgattccagtaatagctcaaaagatgcaagggagagaatggcgtcaatgaggaagctcattattgctgtgatcctttgcatcatattcatggcggtcgaagtggttggaggtatcaaagcaaacagtttggcaatcttgactgatgcagcccatctcctttcggatgttgcggcctttgccatatctttgttctctctttgggcagctggatgggaagctacaccacagcagtcatatgggtttttccgtatagaaattcttggtgccctggtttctattcagctcatatggctccttgctggtattcttgtctatgaagctattgtaaggctcattaatgaaagtggtgaggtccagggctccctcatgtttgctgtctcagcatttggcttatttgttaacatcataatggctgtcttgcttggtcatgaccatggacatggacacggacatggtcatgggcatggacattcccatgaccatgatcatggtggttctgaccatgaccatcaccaccatgaagatcaagagcatggccatgtacatcaccacgaagatggccatggtaattcaattaccgtcaatctccatcaccatccaggcactggacaccaccaccatgatgctgaggaaccattgctcaagagtgatgctggttgtgacagcacccaatctggtgccaaggatgccaagaaggctcgtcgtaatatcaatgtacacagtgcttatctgcatgtgcttggggattcaatccagagcatcggtgtgatgattggaggggctatcatctggtacaagcccgagtggaagattattgatctcatctgcaccctcatcttctccgtgatcgtactcttcaccacaatcaagatgctgcgcaacatccttgaggtcctgatggagagcacgccccgcgagatcgatgccaccagccttgagaatggcctccgcgacatggacggtgtggttgcagtacatgagctgcacatctgggccataacggtggggaaggttctcctggcgtgccatgtgacaatcactcaggacgcagacgctgatcaaatgctggacaaggtgattgggtacatcaagtctgagtacaacatcagccatgtgaccattcagattgagcgcgagtag</cdnaseq> |
| Protein Sequence |
<aaseq>MDSHNSAPPQIAEVRMDISSSTSVAAGNKVCRGAACDFSDSSNS SKDARERMASMRKLIIAVILCIIFMAVEVVGGIKANSLAILTDAAHLLSDVAAFAISL FSLWAAGWEATPQQSYGFFRIEILGALVSIQLIWLLAGILVYEAIVRLINESGEVQGS LMFAVSAFGLFVNIIMAVLLGHDHGHGHGHGHGHGHSHDHDHGGSDHDHHHHEDQEHG HVHHHEDGHGNSITVNLHHHPGTGHHHHDAEEPLLKSDAGCDSTQSGAKDAKKARRNI NVHSAYLHVLGDSIQSIGVMIGGAIIWYKPEWKIIDLICTLIFSVIVLFTTIKMLRNI LEVLMESTPREIDATSLENGLRDMDGVVAVHELHIWAITVGKVLLACHVTITQDADAD QMLDKVIGYIKSEYNISHVTIQIERE</aaseq> |
| Gene Sequence |
<dnaseqindica>1881..3137#atcctaccccccgttctctcctccccatctccaacgcacgcacgcgccatcaccaccacctcgacgccggcggcgacgaccacggcgacggcaacggcggcggcggcagagaagccctcctcatccccaaggttagcgcctcatcgccgcatccccatcccctttcccaccacctcttcctacgatggattcgtcgtccccaccgagagaccagatcaacctctgctcctctctcgttcgttccacgaatctgctcttcgctcgccgcgggtttccctggggtcattccctgttgctgttattgtttcggattttggagcgctagtttttttttttttgtttaggatggaatattgtttcatggaggaggaggagaaatcaggggagcggcggttacgggtcacgggattgggttgttcgactcgaggttacgggttgctactgcgggattgggttgttcgagtggaggtgtggggtctcgcttcgattcgcttctccgtccatttgatcgggggagagaaaaatttttcaaaatcggtcgaatcacgagtccctgtctccaattgcggtgttacggggtgatgatagggatcgatttttggtcgtttcctccttgggttcttcctaacactacagattcgattggtctggagtaggtttcaactttcgtcagccacaaactgtttgtccgcgagcacggcgtcattgaattggcgaaataaatcgatcaatcaatcaatcagcgttggtccctgaccagtccgtcctcgtgtccaatgaaaagcttccgatggatggatggattggttggaaaatctcattacgatagctctggagtgcttcattagtttcattatattgtccttttggatttgtggacatacactctaatgtaggttatcgtaaacatgaatgaatgccgattagcttgctcccttggtggtgttcccctcttgtgctttcgctgtaaccagcgattgccggttgccttcggttaggtagagagaacttgatctgtttgagggtattttgatttacgaagtacctacttcaatcttgtgacgtttgtttgcaatcatgtgctgaatgtctagttatgtttagggggaccttcttgttgttggattagtgcgacttaattaatcttccctttcgtgatactgtcacttttagttggaaaagactgccaggtgccagctaactgttcttgtactgccagcacgacaattctagtgctctccttctgcattcagttttatggtttttttatttcctgttttgttgtgcttttttaatacatcttgaaagctttagcctgactaagaaaatggtttcattatttgcaatgcttatattatatttgcactagcaagaactatgcacttgctatatttgttgagcaaagagacattggcaccttctaaaaacgaacatatttacttctattcattatatcctttggccaacctttttgtacctgctactgttgtctcctggttaggaaggtggtactgatgcacatttttttaatgtgccgcttaacaaaaggctactcattgttacctggcataagtaccataaaagtacgctctgccatggcacggagattttttacttgtaaacagtgttgcctatgttatatatgtttgatgttttaacttcgttattcattcatgttaagaatgttcatgccaccttttactttatgaagtgctgttcagtttttttcctcccccagtgacacaagaaaggattcttatcactagcttttcgcactatttctaccaggaaccttatgttaacatgttttctcagagcatgagaagtaaatatagcatcatctttgtacttgtgtattgacatgattcttttccccctagatggacagccataactcagcacctccccagattgctgaagtgagaatggacatctcatcatctacttctgtagcagctgggaacaaagtttgcagaggtgctgcttgtgacttttctgattccagtaatagctcaaaagatgcaagggagagaatggcgtcaatgaggaagctcattattgctgtgatcctttgcatcatattcatggcggtcgaagtggttggaggtatcaaagcaaacagtttggcaatcttgactgatgcagcccatctcctttcggatgttgcggcctttgccatatctttgttctctctttgggcagctggatgggaagctacaccacagcagtcatatgggtttttccgtatagaaattcttggtgccctggtttctattcagctcatatggctccttgctggtattcttgtctatgaagctattgtaaggctcattaatgaaagtggtgaggtccagggctccctcatgtttgctgtctcagcatttggcttatttgttaacatcataatggctgtcttgcttggtcatgaccatggacatggacacggacatggtcatgggcatggacattcccatgaccatgatcatggtggttctgaccatgaccatcaccaccatgaagatcaagagcatggccatgtacatcaccacgaagatggccatggtaattcaattaccgtcaatctccatcaccatccaggcactggacaccaccaccatgatgctgaggaaccattgctcaagagtgatgctggttgtgacagcacccaatctggtgccaaggatgccaagaaggctcgtcgtaatatcaatgtacacagtgcttatctgcatgtgcttggggattcaatccagagcatcggtgtgatgattggaggggctatcatctggtacaagcccgagtggaagattattgatctcatctgcaccctcatcttctccgtgatcgtactcttcaccacaatcaagatgctgcgcaacatccttgaggtcctgatggagagcacgccccgcgagatcgatgccaccagccttgagaatggcctccgcgacatggacggtgtggttgcagtacatgagctgcacatctgggccataacggtggggaaggttctcctggcgtgccatgtgacaatcactcaggacgcagacgctgatcaaatgctggacaaggtgattgggtacatcaagtctgagtacaacatcagccatgtgaccattcagattgagcgcgagtaggcttgaccgcttgagacaggtaggtagtgttgatgatagaacggatcatcttcatctcatctcatgggaccaacttatcaggaacctgtttcactggttttatgcagttactgttagctctgcagtgcaaatcagatcagcagagtccaacaattcctgcaggttcatctgaatgttagcttctgatgctgtttattactataagtacgtgttattagtactatcttagtcaattaggtgagttgatgttaatcagtttcgtagtcggttgtattcacatgggtgcagttttcagacaagttttcaggcacctgtgagtacgtcaacctgccttctgcgtctgtagtctagcgcccagccgtactagtttttatgtaaatctgcactggcatgggaaataataaccaagtttcgtttggcctt</dnaseqindica> |
| External Link(s) |