Difference between revisions of "Os01g0898300"

From RiceWiki
Jump to: navigation, search
(Undo revision 176623 by Wuxt (talk))
(Evolution)
Line 11: Line 11:
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
 
Root elongation is determined by two successive processes: cell elongation and cell proliferation (Beemster et al., 2003). In rice, several genes controlling division and differentiation in root growth and development have been identified through genetic screens (Rebouillat et al., 2009). Here,  we cloned OsSPR1, a novel mitochondrial gene involved in root cell elongation. Loss of function of OsSPR1 resulted in defective root elongation, including primary root, adventitious root and lateral root elongation; notably, the defects were more severe in lateral roots and adventitious roots. Analysis of the different root zones revealed similar arrangements of cells in those zones compared with the wild type, but reduced cell length was observed in the spr1 roots,
 
Root elongation is determined by two successive processes: cell elongation and cell proliferation (Beemster et al., 2003). In rice, several genes controlling division and differentiation in root growth and development have been identified through genetic screens (Rebouillat et al., 2009). Here,  we cloned OsSPR1, a novel mitochondrial gene involved in root cell elongation. Loss of function of OsSPR1 resulted in defective root elongation, including primary root, adventitious root and lateral root elongation; notably, the defects were more severe in lateral roots and adventitious roots. Analysis of the different root zones revealed similar arrangements of cells in those zones compared with the wild type, but reduced cell length was observed in the spr1 roots,
 
suggesting that reduced root length in spr1 resulted from reduced cell elongation.
 
suggesting that reduced root length in spr1 resulted from reduced cell elongation.

Revision as of 10:11, 3 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. This study has identified a novel mitochondrial protein, OsSPR1, that is involved in maintaining Fe homeostasis in rice. The large reduction of Fe content observed in the leaves but not the roots of Osspr1 mutant plants under Fe(II) and Fe(III) nutrient supply, and the normal Fe deficiency response for both strategy I and II marker genes in the leaves but not the roots indicate a defect in Fe homeostasis. In addition, root development was also compromised in Osspr1 mutant plants. It is likely that the defective roots of Osspr1 plants will have a secondary effect on nutrient uptake. However, if reduced Fe uptake as a result of damaged roots was the primary reason for the reduced Fe content in the leaves, the Fe content and the Fe deficiency response would have been duced and activated, respectively, in the roots. However, the Fe content in roots of Osspr1 mutant plants was similar to that of wild-type plants (Fig. 6e). Also, no Fe deficiency response was observed in roots (Fig. 7). However, a lower Fe content was observed in the mutant leaves, which was inconsistent with the induction of Fe-responsive genes (Figs 6c, 7). These results indicate that OsSPR1 plays a role in maintaining Fe (and other metal) homeostasis between roots and leaves.

Expression

Please input expression information here. The expression pattern of OsSPR1 was determined usingt he GUS gene driven by the OsSPR1 promoter transferred into wild-type plants. GUS staining in transgenic plants indicated that OsSPR1 was ubiquitously expressed in all plant organs, including the root, leaf, stem and spikelet (Fig. 3a–r). OsSPR1 was expressed in primary and lateral roots, both in mature regions and in root tips. Strong expression was observed in the root tip (in the meristem and lateral root initiation regions), where dividing cells are present. The expression of OsSPR1 in the root is mainly associated with vascular tissues (Fig. 3b,d,h). Semiquantitative RT-PCR analysis using SPR1-specific primers showed that SPR1 was expressed at relatively similar levelsin all tissues, including the root, stem base, stem, leaf and panicles (Fig. S3), consistent with the GUS staining patterns observed.

Evolution

Root elongation is determined by two successive processes: cell elongation and cell proliferation (Beemster et al., 2003). In rice, several genes controlling division and differentiation in root growth and development have been identified through genetic screens (Rebouillat et al., 2009). Here, we cloned OsSPR1, a novel mitochondrial gene involved in root cell elongation. Loss of function of OsSPR1 resulted in defective root elongation, including primary root, adventitious root and lateral root elongation; notably, the defects were more severe in lateral roots and adventitious roots. Analysis of the different root zones revealed similar arrangements of cells in those zones compared with the wild type, but reduced cell length was observed in the spr1 roots, suggesting that reduced root length in spr1 resulted from reduced cell elongation.

References

Please input cited references here.

 Beemster GTS, Fiorani F, Inze´ D. 2003. Cell cycle: the key to plant growth control? Trends in Plant Science 8: 154–158.
 Rebouillat J, Dievart A, Verdeil J, Escoute J, Giese G, Breitler J, Gantet P, Espeout S, Guiderdoni E, Pe´rin C. 2009. Molecular genetics of rice root development. Rice 2: 15–34.
 Liqiang Jia;Zhongchang Wu;Xi Hao;Chris Carrie;Libin Zheng;James Whelan;Yunrong Wu;Shoufeng Wang;Ping Wu;Chuanzao Mao.  Identification of a novel mitochondrial protein, short postembryonic roots 1 (SPR1), involved in root development and iron homeostasis in Oryza sativa  New Phytologist, 2011, 189(3): 843-855.
 Jia LiQiang . Is Reactive Oxygen Species (ROS) the underlying factor for inhibited root growth in Osspr1?  Plant Signaling & Behavior, 2011, 6(7): 1024-1025.

Structured Information

Gene Name

Os01g0898300

Description

Armadillo-like helical domain containing protein

Version

NM_001051627.1 GI:115441624 GeneID:4325109

Length

6243 bp

Definition

Oryza sativa Japonica Group Os01g0898300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:40808134..40814376

Sequence Coding Region

40808350..40808496,40808589..40808780,40808893..40809024,40809123..40809260,40809362..40809562
,40809661..40809788,40810023..40810098,40810453..40810602,40810698..40811057
,40811144..40811296,40811384..40811676,40811792..40811988,40812071..40812228
,40812533..40812580,40812912..40813040,40813123..40813237,40813321..40813436
,40813737..40813811,40813982..40814116

Expression

GEO Profiles:Os01g0898300

Genome Context

<gbrowseImage1> name=NC_008394:40808134..40814376 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:40808134..40814376 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggggtgatgtcgcggcgggtgctgcctgcctgcagcagcctctgctacttctgcccctcgctgcgggcgcgctcgcgtcagcccgtcaagaggtacaagaagatcatcgcggagatctaccagcttccaccggatggtgaaccgaatgataggaggattgggaagctctgtgattatgtctcgagaaatccgacgcggatacccaagatcacagagtaccttgaggagaggtgctataaagatctgagacatgagaatttcaccttggccaaagttgtaccatgtatatacaggaagcttctgtgttcatgcaaggatcatacaccattgctggccacaagcacattgagcattattcgtactcttctcgatcagagaatgaatgatgatttgcgggtcctgggttgtctaatgcttgttgactttctcaacggccaggttgatagcacgcatatgtttaatctggaaggcctcataccaaaactttgccaaattagtcaagaactaagggaagatgacaaagggttccgcctccgatgtgctgcacttcaggctcttgcttctatggtccaatacatgggtgaccactcacacatttccatggaacttgatgaagttgtgtccgtgatcgtaagttgttatgaggttaatcaaactctctcaataaaagaggttgtcaggcttcaagatgatgatgatttggtaatcaatggaagtctgactgggttgccagtatctgggcaaaatagtgccaaagtggcatctgatacaatgtctgcatctgaaaatccagcacattgggcaagggtttgcttacgtaatatggccagtatcgccaaggaggcaacaacagtgtggcgtgttcttgatcctcttttccgcctttttgatagccacaactattggtctcctgaaaatgggattgcattttctattctacaagaaatgcaggcactgatggacaaatcagggcaaaatggccatttgctgttatctttcaccataaaacacatagatcataagagtgttgccaagaagcctgccaagcaaacaagcattttaaaagttgcttcgcttcttgcaaaacatgcaaagttgaaggcgtcggtgacaatagcaagtgcaacaagcgacttaataaagcacttgcgcaaatgcatgcattgtgctgttgaatcaccaaatgctcaaaatgatgttgacaagtggaacagtgcactttatgtggccttggaggagtgcctggtgcaattgacagaaaaggttggtgatgttgggcctgttcttgacatggtgggagtaatgcttgagaatctctcttgtactgccaccattgccagaacaacaatttcatcagttttccgcacagtgcaaatagcagcttccatccacaagtcattgtacaaccagaaggcatttcctgaagctttgtttcatcagcttctcttagcaatgatgcacccagacaaaaagacaagggttggttcacatcgtgtcctatccaccattattgcaccttcacttctatgcccatggtcaggcataagttttcctatccctgtgaagggcaatgattcacagagcattactttgttggctctttctgccttttcttctgaggccgtaatggatgaagtccggatcaaaagcaggacccatgaacagttacaaaacaatgtaaaaccagaaactgtagttggctctgagaacggatacacacatacagaaccaaattcaaggaagagccctggtcttggaattccattgaaagatgaaaatcttaagttcatgaagctgaacagtagccaacttgttctcctcctttcatcaatttggagtcaagcacctctagaagataactcaccagcaaattttgaagcaatgtgccatacctacaatattgctttattgtgttcaatgacaaagagctctagtcacgcagcattagttcgatgtttccagttggccttctctctcaggaggatgtcccttaaccaagaaaatggtttgcagccatcacgtaggaggtgtttgtatacaatggcatcagcaatgctgattttttcagcaaaagttgctgatattcctcagacaattcctcttgtgaaagcagcagttccagagaaaatggtcgaccctcatctttgcctgattgatgattgcagactcgttattagttcaccacagtcatctaacagtgggatagtttatggttctgaggaagatgaaagtgatgcacgcaattttctttcttgtgtaaataaaaatgatacacagttaaaagaaattgtgatatcccacttcaaggagaagtttgaaaatctatcagagaagtttaatggtatagaagagcagcttcttcaggagttttccctggatgattcattccctctcagtgctccactattcatggaaacaccacactcttgttcgatgtacgctgaaaaggatgaccattgttttgatgaggaagtcattccttgtgagatggatgatgacgatgacatcgtttttgaacacagtggatcgcaatctgacaggaaaacctctggatctatggcttcatcagatgttctaaacgtcaatcaactaatagaatcggttcatgagacagcaaggcaggttgctaatgctccagtttctgccaaccttgtaccctacgatcaaatgaagagccaatgcgaagccctagtcatggagaagcaacagaagatgtctgttctcctgagcttcaaacactcgaggaccgattcccgtggctcgactgcagaaaatggactggaaacaaacgagtcatctgctcggtctgagcctgagacgcagtcgacgaggaaggagcgaatgcgacgcagcgactcggcatcaagcgaatctgaccggtcgttcaggctgccaccggcaagcccatatgacaagttcatgagagctgctgggcgatag</cdnaseq>

Protein Sequence

<aaseq>MGVMSRRVLPACSSLCYFCPSLRARSRQPVKRYKKIIAEIYQLP PDGEPNDRRIGKLCDYVSRNPTRIPKITEYLEERCYKDLRHENFTLAKVVPCIYRKLL CSCKDHTPLLATSTLSIIRTLLDQRMNDDLRVLGCLMLVDFLNGQVDSTHMFNLEGLI PKLCQISQELREDDKGFRLRCAALQALASMVQYMGDHSHISMELDEVVSVIVSCYEVN QTLSIKEVVRLQDDDDLVINGSLTGLPVSGQNSAKVASDTMSASENPAHWARVCLRNM ASIAKEATTVWRVLDPLFRLFDSHNYWSPENGIAFSILQEMQALMDKSGQNGHLLLSF TIKHIDHKSVAKKPAKQTSILKVASLLAKHAKLKASVTIASATSDLIKHLRKCMHCAV ESPNAQNDVDKWNSALYVALEECLVQLTEKVGDVGPVLDMVGVMLENLSCTATIARTT ISSVFRTVQIAASIHKSLYNQKAFPEALFHQLLLAMMHPDKKTRVGSHRVLSTIIAPS LLCPWSGISFPIPVKGNDSQSITLLALSAFSSEAVMDEVRIKSRTHEQLQNNVKPETV VGSENGYTHTEPNSRKSPGLGIPLKDENLKFMKLNSSQLVLLLSSIWSQAPLEDNSPA NFEAMCHTYNIALLCSMTKSSSHAALVRCFQLAFSLRRMSLNQENGLQPSRRRCLYTM ASAMLIFSAKVADIPQTIPLVKAAVPEKMVDPHLCLIDDCRLVISSPQSSNSGIVYGS EEDESDARNFLSCVNKNDTQLKEIVISHFKEKFENLSEKFNGIEEQLLQEFSLDDSFP LSAPLFMETPHSCSMYAEKDDHCFDEEVIPCEMDDDDDIVFEHSGSQSDRKTSGSMAS SDVLNVNQLIESVHETARQVANAPVSANLVPYDQMKSQCEALVMEKQQKMSVLLSFKH SRTDSRGSTAENGLETNESSARSEPETQSTRKERMRRSDSASSESDRSFRLPPASPYD KFMRAAGR</aaseq>

Gene Sequence

<dnaseqindica>5881..6027#5597..5788#5353..5484#5117..5254#4815..5015#4589..4716#4279..4354#3775..3924#3320..3679#3081..3233#2701..2993#2389..2585#2149..2306#1797..1844#1337..1465#1140..1254#941..1056#566..640#261..395#gaggtttgatcttggtttcgatccgaagggtctcggttggctgcgtgggaagggggaggaggaagaaggcgacctgctatctaatcctctaccccctctgctgcgaaaattctctgctgtttgctcaagcatcttgctgcttggagccttggatcgaagagagttttagttcttggagttctgagaattgtgttgcttgagccgaattcgatcccaaaaaggctcttttttgggaggctttgaggaggaggaggaagaagatgggggtgatgtcgcggcgggtgctgcctgcctgcagcagcctctgctacttctgcccctcgctgcgggcgcgctcgcgtcagcccgtcaagaggtacaagaagatcatcgcggagatctaccagcttccaccggtatggcgattactgaatcctgtcttggcatttcagccatttctgatgcttagttgtagtctctgcgatttgggtctgtggtcaaatagttctagtttctgcgaattggagtctgtggtcaaatgtgtggagggagtttgttgattgagggtgtgatgttgttgctgtaggatggtgaaccgaatgataggaggattgggaagctctgtgattatgtctcgagaaatccgacgcggatacccaaggtaacacattttgatctcctctctgtttttactagaattgtcgcgcaatctgttagcttgaatagtttagactgaatttccagtatttctgaaagcagtctttataggtaccgagtagttaccacataatggctgatttacactgcattgctttagtgtgatggtgattccttttgccagagtacaaccgatcaactttcgctagcaccgatcactagctggaatgattttaggctgtttaagtaggacttaccgagatgaatgaatttgtggaactcggaactgattttatgtctgcagatcacagagtaccttgaggagaggtgctataaagatctgagacatgagaatttcaccttggccaaagttgtaccatgtatatacaggaagcttctgtgttcatgcaaggatcatacgtaagtgtaaaggctctattctgccagtcaagcacccatagcaaatgtttgctgctgtactgaccatattattcttgattcagaccattgctggccacaagcacattgagcattattcgtactcttctcgatcagagaatgaatgatgatttgcgggtcctgggttgtctaatgcttgttgactttctcaacggccaggttattgacgactgtaacaaattgcacctacttggtttgctagaaatctgccatctgtttggtttaatttgagttcatgtaggttgatagcacgcatatgtttaatctggaaggcctcataccaaaactttgccaaattagtcaagaactaagggaagatgacaaagggttccgcctccgatgtgctgcacttcaggctcttgcttctatggtaagaaaagtttttacttgattctctgatgaaatggataaggtagtcttatatgttgcgagctagccatttagggctaatttacagtagatttgttggaccagaaataataatgtagaacaaaataaggaactacattcaactattatacaatttgttttgcaaatataacatttttttaatgttggttatattgatattgcttgagaattcccaacagataatcctatacttgcattactggttcttgccaactgatgccattaaatcagtctattgattaaatttaactttttaatcctaatatactcatttaccactttgtaatcaggtccaatacatgggtgaccactcacacatttccatggaacttgatgaagtaagtccttatcactctgtgttgggctagaatgttaagagttaagacttaattctcattcatggttgatagatgcctcctggtgaatatttgttctcttgttggaattgcataagattcatctttggagcatagacaagttgatgccattaatactacagatagacttgttgaataagtggaagatatttgattagtctatgaatagaaaaaaaaagtagcatgatagtttcatttgaagtgcgccagaaacagtaattcagtaagggttctgattagtctctgaattcattcttgaacccaggttgtgtccgtgatcgtaagttgttatgaggttaatcaaactctctcaataaaagaggttgtcaggcttcaagatgatgatgatttggtaatcaatggaagtctgactgggttgccagtatctgggcaaaatagtgccaaagtggcatctgatacaatgtgagaatttctgctaatgtaacggcccatttccacactcgatttgtgcccttgtcatcttaatgacttagtgtgttgacaggtctgcatctgaaaatccagcacattgggcaagggtttgcttacgtaatatggccagtatcgccaaggaggcaacaacagtgtggcgtgttcttgatcctcttttccgcctttttgatagccacaactattggtctcctgaaaatgggattgcattttctattctacaagaaatgcaggcactgatggacaaatcaggtgcaaaatttttcacccatgctatttgtttctctttttgtgccattttttttggttttgttagtgtttaacagcagaaagatttagtgctcttctaaatcttgtttcttaacagggcaaaatggccatttgctgttatctttcaccataaaacacatagatcataagagtgttgccaagaagcctgccaagcaaacaagcattttaaaagttgcttcgcttcttgcaaaacatgcaaagttgaaggcgtcggtgacaatagcaagtgcaacaagcgacttaataaagcacttgcgcaaatgcatgcattgtgctgttgaatcaccaaatgctcaaaatgatgttgacaagtggaacagtgcactttatgtggccttggaggagtgcctggtgcaattgacagaaaaggttcattatgctgtattattcctttgttacattactacattttgctttcatcagagagacattaaaggctgttaattcattgaataggttggtgatgttgggcctgttcttgacatggtgggagtaatgcttgagaatctctcttgtactgccaccattgccagaacaacaatttcatcagttttccgcacagtgcaaatagcagcttccatccacaagtcattgtacaaccagaaggcaagttttctagtgtgttcaccattgcaggagaattttgctattgaacaaaagtgttaattggcaattccttgttaatatttcaggcatttcctgaagctttgtttcatcagcttctcttagcaatgatgcacccagacaaaaagacaagggttggttcacatcgtgtcctatccaccattattgcaccttcacttctatgcccatggtcaggcataagttttcctatccctgtgaagggcaatgattcacagagcattactttgttggctctttctgccttttcttctgaggccgtaatggatgaagtccggatcaaaagcaggacccatgaacagttacaaaacaatgtaaaaccagaaactgtagttggctctgagaacggatacacacatacagaaccaaattcaaggaagagccctggtcttggaattccattgaaagatgaagtatgtactccaactagtattcttattgaacttggtattttctggtcttggtgttttcggatgtccagctgacacattttcttccactgaagcagaatcttaagttcatgaagctgaacagtagccaacttgttctcctcctttcatcaatttggagtcaagcacctctagaagataactcaccagcaaattttgaagcaatgtgccatacctacaatattgctttattgtgttcaatgacaaaggtaggtcacttaatctagttcattcttgttatacaataggcaaaaagaattgttcaagtaacttgacttaacattgttctgcatgccttgaaattatcaaagaatagccaaagggaaagataccgtcttttcccttttggcatggagttatttcatattatataatatttttttatactctatttttacacaagatagattctttagaatattttattgatgtaataggcatggattaacactttttttaagatttccctgctagtgtgagtttgactagtgatgtcaacttctcctttggacttgaaattgtgtgctatatttgtgagattgaccattgaattttcgttgcagagctctagtcacgcagcattagttcgatgtttccagttggccttctctctcaggaggatgtcccttaaccaagaaagtaagtttatcctcatttgcctgctctttaaagtttttgcttttgtatatcaaaatgatgatgcaaaaaaaaagtgacaactagctagggattttttccaaataggaatatcattttttctaataccagtatattttagccattgcgtccaacttcaagtttattatatttcctatcaatctagtcatttgatacctgcttgatttattcttacattttctactgtaaataaagatggtttgcagccatcacgtaggaggtgtttgtatacaatggcatcagcaatgctgattttttcagcaaaagttgctgatattcctcagacaattcctcttgtgaaagcagcagttccagagaaaatggttagttgattcctgattttgaatatgcttgctctatatatatctctaatgtgacatttttcaatttactctgaattcgcttattgatgtttttgtaggtcgaccctcatctttgcctgattgatgattgcagactcgttattagttcaccacagtcatctaacagtgggatagtttatggttctgaggaagatgaaagtgatgcacgcaattttctttcttgtgtaaataaaaatgatacacagttaaaagaaattgtgatatcccacttcaaggagaagtttgaaaatctatcagaggtatacattcagatttacattatgagagcgtgttttcttgatttctctgttcacaatcaagaagttatttgacgattaagtgtcttcactgcaaattgcagaagtttaatggtatagaagagcagcttcttcaggagttttccctggatgattcattccctctcagtgctccactattcatggaaacaccacactcttgttcgatgtacgctgaaaaggatgaccattgttttgatgaggtccgtactgattctctatagttaggtgattttttgttatttatgaattgctgttgtattaacttttttggttgcatctgcgtcccttgtgcttccaggaagtcattccttgtgagatggatgatgacgatgacatcgtttttgaacacagtggatcgcaatctgacaggaaaacctctggatctatggcttcatcagatgttctaaacgtcaatcaactaatagaatcggtatgcgccatttctgtctacaacaatggcacatgaagatcactcgctattttctagatctcttacagtcccctcatccgtttgtaatcaaacgacttttttttttcttcaggttcatgagacagcaaggcaggttgctaatgctccagtttctgccaaccttgtaccctacgatcaaatgaagagccaatgcgaagccctagtcatggagaagcaacagaagatgtctgttctcctgagcttcaaacactcgaggaccgattcccgtggctcgactgcagaaaatggactggaaacaaacgaggcatgttcatcttgacaggaaaaaaaaaatctatccatcactactgaaatctttgaaaatgtcctgaaaaactcatcaacatcttgttgcagtcatctgctcggtctgagcctgagacgcagtcgacgaggaaggagcgaatgcgacgcagcgactcggcatcaagcgaatctgaccggtcgttcaggctgccaccggcaagcccatatgacaagttcatgagagctgctgggcgataggctggtgcaatgcaatgcgatggcgccaaggatctgatactagttttcaagcctgtatacagaaatgtttttacagatacaagtcttctaaagctgtttcttttcattgtcgccttgtattttttattcttctgagtgtaaatttctcgagaaggtgtacaaatttctgttactgttgtagagacccagaataaataaaagtataggcattggtgc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0898300, RefSeq:Os01g0898300