Difference between revisions of "Os09g0511000"
Jidongchao (talk | contribs) |
|||
| Line 1: | Line 1: | ||
| − | + | The rice gene Os09g0511000 is known as ''OsCERK1''. ''OsCERK1'' encodes a receptor-like kinase called OsCERK1 which is essential for chitin elicitor signaling in rice cells. | |
| − | |||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | === '' OsCERK1 ''encoded a receptor-like kinase called OsCERK1 === | |
| + | :: ''OsCERK1'' encoded a receptor-like kinase consisting of 624 amino acid residues, containing a signal peptide, an extracellular domain, a transmembrane region and an intracellular Ser/Thr kinase domain (Figure 1). [[File:F 1.png|thumb|Figure 1 Amino acid sequence of OsCERK1 predicted from the cDNA. Underlining indicates the sequence corresponding to the LysM motif. EC, extracellular domain; IC, intracellular domain; SP, signal peptide; TM, transmembrane domain.]] OsCERK1 is a plasma membrane protein containing one LysM motif in the extracellular domain and an intracellular Ser/Thr kinase domain. <ref name=ref 1/> | ||
| + | === OsCERK1 is essential for chitin elicitor signaling in rice cells === | ||
| + | :: Knockdown of ''OsCERK1'' resulted in a marked suppression of the defense responses in rice cells induced by chitin oligosaccharides, indicating a central role for OsCERK1 in chitin signaling in rice. The results of yeast two-hybrid assay indicate that the extracellular domain of OsCERK1 can interact with that of CEBiP, suggesting that OsCERK1 and CEBiP have the potential to form homo- and hetero-oligomers through interaction of their LysM-containing extracellular domains. <ref name=ref 1/> | ||
| + | :: These results indicated that, in the absence of chitin oligosaccharide elicitor, a major portion of CEBiP exists most likely as homo-oligomers in the plasma membrane, whereas OsCERK1 is mostly present as a monomer. However, when the chitin oligosaccharide elicitor is added to the cells, a portion of CEBiP and OsCERK1 appear to form a hetero-oligomer receptor complex. <ref name=ref 1/> | ||
| + | :: Other researchers also confirm that these two proteins form a receptor complex that transduces the chitin signal to downstream components for immune responses. </ref name=ref 2> </ref name=ref 3> </ref name=ref 4> | ||
| + | ===OsCERK1 signal pathway === | ||
| + | :: OsRacGEF1 as a guanine nucleotide exchange factor for OsRac1 (rice small GTPase). OsRacGEF1 interacts with OsCERK1 and is activated when its C-terminal S549 is phosphorylated by the cytoplasmic domain of OsCERK1 in response to chitin. Activated OsRacGEF1 is required for chitin-driven immune responses and resistance to rice blast fungus infection. Further, a protein complex including OsCERK1 and OsRacGEF1 is transported from the endoplasmic reticulum to the PM. OsCEBiP, OsCERK1, OsRacGEF1, and OsRac1 function as key components of a ‘‘defensome’’ critically engaged early during chitin-induced immunity. <ref name=ref 6> | ||
| + | |||
===Expression=== | ===Expression=== | ||
| − | + | [[File:F 2.png|thumb|Figure 2 Expression patterns of the ''OsCERK1'' gene in each part of the rice plant. Sh, shoot; R, root; PS, proximal shoot; St, stem; F, flower]] | |
| + | :: ''OsCERK1'' was expressed in all tissues tested, with weak expression in the flowers (Figure 2). <ref name=ref 1/> | ||
| + | |||
===Evolution=== | ===Evolution=== | ||
| − | + | :: Phylogenies were analyzed by multiple sequence alignment of the protein sequences of the LysM receptor-like kinases. The names of proteins described previously (Zhang et al., 2007) </ref name=ref 2> are shown in parentheses for ease of comparison. [[File:F 3.png|thumb|Figure 3 Phylogenetic tree of OsCERK1 and related plant LysM receptor-like kinases.]] The scale indicates the base substitution rate, and numbers at the nodes represent bootstrap values with 1000 replicates (Figure 3). <ref name=ref 1/> | |
| − | |||
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | Department of Life Sciences, Faculty of Agriculture, Meiji University, 1-1-1 Higashi-Mita, Tama-ku, Kawasaki, Kanagawa 214-8571, Japan | |
| + | Division of Plant Sciences, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan | ||
| + | Biotechnology Research Center, The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657, Japan | ||
| + | Laboratory of Plant Molecular Genetics, Graduate School of Biological Sciences, Nara Institute of Science and Technology, 8916-5 Takayama, Ikoma, Nara 630-0192, Japan | ||
| + | Agricultural and Veterinary Research Laboratories, Meiji Seika Kaisha, Kohoku-ku, Yokohama 222–8567, Japan | ||
| + | |||
==References== | ==References== | ||
| − | + | <references> | |
| + | <ref name=ref 1> Takeo Shimizu, Takuto Nakano and Daisuke Takamizawa et al. (2010) Two LysM receptor molecules, CEBiP and OsCERK1, cooperatively regulate chitin elicitor signaling in rice. The Plant Journal, 64, 204–214 </ref> | ||
| + | </ref name=ref 2> Kaku, H., Nishizawa, Y., Ishii-Minami, N., Akimoto-Tomiyama, C., Dohmae, N., Takio, K., Minami, E., and Shibuya, N. (2006). Plant cells recognize chitin fragments for defense signaling through a plasma membrane receptor. Proc. Natl. Acad. Sci. USA103, 11086–11091. </ref> | ||
| + | <ref name=ref 3> Shimizu, T., Nakano, T., Takamizawa, D., Desaki, Y., Ishii-Minami, N., Nishizawa, Y., Minami, E., Okada, K., Yamane, H., Kaku, H., and Shibuya, N. (2010). Two LysM receptor molecules, CEBiP and OsCERK1, cooperatively regulate chitin elicitor signaling in rice. Plant J.64, 204–214. </ref> | ||
| + | <ref name=ref 4> Shinya, T., Motoyama, N., Ikeda, A., Wada, M., Kamiya, K., Hayafune, M., Kaku, H., and Shibuya, N. (2012). Functional characterization of CEBiP and CERK1 homologs in arabidopsis and rice reveals the presence of different chitin receptor systems in plants. Plant Cell Physiol.53, 1696–1706. </ref> | ||
| + | <ref name=ref 5> Zhang, X.C., Wu, X., Findley, S., Wan, J., Libault, M., Nguyen, H.T., Cannon, S.B. and Stacey, G. (2007) Molecular evolution of lysin motif-type receptorlike kinases in plants. Plant Physiol.144, 623–636. </ref> | ||
| + | <ref name=ref 6> Akira Akamatsu, Hann Lin Wong and Masayuki Fujiwara et al. (2013) An OsCEBiP/OsCERK1-OsRacGEF1-OsRac1 Module Is an Essential Early Component of Chitin-Induced Rice Immunity. Cell Host & Microbe 13, 465–476 </ref> | ||
| + | </references> | ||
| + | |||
==Structured Information== | ==Structured Information== | ||
Revision as of 11:18, 3 June 2014
The rice gene Os09g0511000 is known as OsCERK1. OsCERK1 encodes a receptor-like kinase called OsCERK1 which is essential for chitin elicitor signaling in rice cells.
Contents
Annotated Information
Function
OsCERK1 encoded a receptor-like kinase called OsCERK1
- OsCERK1 encoded a receptor-like kinase consisting of 624 amino acid residues, containing a signal peptide, an extracellular domain, a transmembrane region and an intracellular Ser/Thr kinase domain (Figure 1). OsCERK1 is a plasma membrane protein containing one LysM motif in the extracellular domain and an intracellular Ser/Thr kinase domain. Cite error: Invalid
<ref>tag;
- OsCERK1 encoded a receptor-like kinase consisting of 624 amino acid residues, containing a signal peptide, an extracellular domain, a transmembrane region and an intracellular Ser/Thr kinase domain (Figure 1).
invalid names, e.g. too many
OsCERK1 is essential for chitin elicitor signaling in rice cells
- Knockdown of OsCERK1 resulted in a marked suppression of the defense responses in rice cells induced by chitin oligosaccharides, indicating a central role for OsCERK1 in chitin signaling in rice. The results of yeast two-hybrid assay indicate that the extracellular domain of OsCERK1 can interact with that of CEBiP, suggesting that OsCERK1 and CEBiP have the potential to form homo- and hetero-oligomers through interaction of their LysM-containing extracellular domains. Cite error: Invalid
<ref>tag;
- Knockdown of OsCERK1 resulted in a marked suppression of the defense responses in rice cells induced by chitin oligosaccharides, indicating a central role for OsCERK1 in chitin signaling in rice. The results of yeast two-hybrid assay indicate that the extracellular domain of OsCERK1 can interact with that of CEBiP, suggesting that OsCERK1 and CEBiP have the potential to form homo- and hetero-oligomers through interaction of their LysM-containing extracellular domains. Cite error: Invalid
invalid names, e.g. too many
- These results indicated that, in the absence of chitin oligosaccharide elicitor, a major portion of CEBiP exists most likely as homo-oligomers in the plasma membrane, whereas OsCERK1 is mostly present as a monomer. However, when the chitin oligosaccharide elicitor is added to the cells, a portion of CEBiP and OsCERK1 appear to form a hetero-oligomer receptor complex. Cite error: Invalid
<ref>tag;
- These results indicated that, in the absence of chitin oligosaccharide elicitor, a major portion of CEBiP exists most likely as homo-oligomers in the plasma membrane, whereas OsCERK1 is mostly present as a monomer. However, when the chitin oligosaccharide elicitor is added to the cells, a portion of CEBiP and OsCERK1 appear to form a hetero-oligomer receptor complex. Cite error: Invalid
invalid names, e.g. too many
- Other researchers also confirm that these two proteins form a receptor complex that transduces the chitin signal to downstream components for immune responses. </ref name=ref 2> </ref name=ref 3> </ref name=ref 4>
OsCERK1 signal pathway
- OsRacGEF1 as a guanine nucleotide exchange factor for OsRac1 (rice small GTPase). OsRacGEF1 interacts with OsCERK1 and is activated when its C-terminal S549 is phosphorylated by the cytoplasmic domain of OsCERK1 in response to chitin. Activated OsRacGEF1 is required for chitin-driven immune responses and resistance to rice blast fungus infection. Further, a protein complex including OsCERK1 and OsRacGEF1 is transported from the endoplasmic reticulum to the PM. OsCEBiP, OsCERK1, OsRacGEF1, and OsRac1 function as key components of a ‘‘defensome’’ critically engaged early during chitin-induced immunity. Cite error: Invalid
<ref>tag;
- OsRacGEF1 as a guanine nucleotide exchange factor for OsRac1 (rice small GTPase). OsRacGEF1 interacts with OsCERK1 and is activated when its C-terminal S549 is phosphorylated by the cytoplasmic domain of OsCERK1 in response to chitin. Activated OsRacGEF1 is required for chitin-driven immune responses and resistance to rice blast fungus infection. Further, a protein complex including OsCERK1 and OsRacGEF1 is transported from the endoplasmic reticulum to the PM. OsCEBiP, OsCERK1, OsRacGEF1, and OsRac1 function as key components of a ‘‘defensome’’ critically engaged early during chitin-induced immunity. Cite error: Invalid
invalid names, e.g. too many
</ref name=ref 2> Kaku, H., Nishizawa, Y., Ishii-Minami, N., Akimoto-Tomiyama, C., Dohmae, N., Takio, K., Minami, E., and Shibuya, N. (2006). Plant cells recognize chitin fragments for defense signaling through a plasma membrane receptor. Proc. Natl. Acad. Sci. USA103, 11086–11091. </ref>
Cite error: Invalid <ref> tag;
invalid names, e.g. too many
Cite error: Invalid <ref> tag;
invalid names, e.g. too many
Cite error: Invalid <ref> tag;
invalid names, e.g. too many
Cite error: Invalid <ref> tag;
invalid names, e.g. too many
</references>
Structured Information
| Gene Name |
Os09g0511000 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001189005.1 GI:297727140 GeneID:9270778 |
| Length |
5016 bp |
| Definition |
Oryza sativa Japonica Group Os09g0511000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 9:20514905..20519920 |
| Sequence Coding Region |
20515369..20515559,20516273..20516306,20516496..20516531 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008402:20514905..20519920 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008402:20514905..20519920 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgcggcgacgagagggtctcgccgcggtacgggctgttcctcacctacccgctctgggacggggagacgctcgaatcggtggccgcgcagtacgggttctcgtcgccggcggagatggagctgatcaggaggtacaaccccgggatgggaggggtctccgggaaggggattgtgttcatcccggtgaaagatccaaatggaagttaccaccctctgaaatcagggtggaatggggaatagcctttctggaggagcgatag</cdnaseq> |
| Protein Sequence |
<aaseq>MRRREGLAAVRAVPHLPALGRGDARIGGRAVRVLVAGGDGADQE VQPRDGRGLREGDCVHPGERSKWKLPPSEIRVEWGIAFLEER</aaseq> |
| Gene Sequence |
<dnaseqindica>465..655#1369..1402#1592..1627#gccctcctcatcggcgcctgtgccttcgcggcggcggcggttgcggcgtccggcgacggttgccgcgccggctgctcgctggccatcgccgcctactacttctccgagggttcaaacctcaccttcatcgccaccatcttcgccatcggcggcggcggctaccaagcgctgctcccctacaacccggccatcaccaacccggactacgtcgtcaccggcgaccgcgtgctcgttcccttcccctgctcctgcctcgggctccccgccgcgcccgcctccaccttcctcgcaggcgccatcccctacccgctccccctcccccgcggcggcggcgacacctacgacgccgtcgccgccaactacgccgacctcaccaccgccgcgtggctggaggccaccaacgcgtacccgccggggaggatccccggcggcgatgggagggtcaacgtcaccatcaactgctcatgcggcgacgagagggtctcgccgcggtacgggctgttcctcacctacccgctctgggacggggagacgctcgaatcggtggccgcgcagtacgggttctcgtcgccggcggagatggagctgatcaggaggtacaaccccgggatgggaggggtctccgggaaggggattgtgttcatcccggtgaaaggtgagtgctactggtttctcagtttgattttgactgttttagcttgtaactgtgagttgcgagaggttttggatgataattgagcatgtgaaaaatgtgaaatgtgaagtgcggtttggattacagtggtttttgcaggtagtttgtgaaaggaagtttggttactgcttgaatgttcttagcatatttatcaatgattggaacttctgagctatgtgcttcttcttttttgctctgctgtccaattttgcttggttgtatttgtgattgatttaaagcaatgcagtaactgagttttggttatacaaagtttaacccctgtcgtatgctatttcacatacacagatcgactttgtgccatggtatgcagtagttttcatgtttcgggagtggtaatctatttgatcctgcatcatggttgtttgaggcatcatgaactcatgtctatgctacatagttggtacaatggtaccggagagagtatcatgcaagtcgaattgccacccttttttttactgatacttgataattagttagttagcataaccagataattaacacaactaactgcaatcattcttcagaaaagctcaccactgtcatttgcttaatctcttctcttaaaaaacagctgttgtcaacaattaatcttctaggtgtcaatctataattctatatatgctaacatcctttactctgttatttatttccagatccaaatggaagttaccaccctctgaaatcagggtaagcattcttcgactgtcaggtgaaattacaactgtgatttcctttattattttctgatatgtatttcttgtgcagtgtaggcattgttcttctcttctgtgagctcttgtgtatctatgctaaggttatcaagaactaaagtgggtattgtcatgaaacactgatgttcaactcacattcttctaggtggaatggggaatagcctttctggaggagcgatagcaggaattgtgatagcttgcattgctattttcattgtggccatatggttgattatcatgttctataggtggcaaaagttcaggaaggccacatcgcgtccatctccagaagaaaccagccaccttggtaatgataaacctcctttcttggctgtaacactcctctagatcaactatgccaaactgttgaacatattacatgctttgtaaagtgcttctgttgtgattttggtatatcagctgctattatttgtgtggtaagtagcttagctagtcttctttttatcattgtacaaactgtatgatttctctgcaaatgctacaactcaaaattaatatgccttgtcaattacagatgatgcttcccaagctgaaggcattaaggttgagagatccatagaattctcatatgaagagatttttaatgcaacacagggattttctatggaacataaaattgggcaaggtggttttggttcagtgtattatgctgagcttagaggcgaggttggttcaacatttttctcatcatggacaacctatcagagtgcattcacacataaatcaataaggaggacacaacattttgatgtgcattcttctatcaatttgaaatgacttctctgctgccttcagaaaactgccataaagaaaatgggcatgcaagcaactcaagaattccttgctgaactgaaggtcttgacacatgttcaccacttgaatctggtgggtggtcttatgattttctgtaataatataacagaaataatctcaactaccaactgaactttacattttgctatgcttacttacagaacgagaagataaactttgattagagtttagtaaagaccataatacctttcaatagggcacggcatcatatttttcatgttggaatagtactctcgagtctctgtactcgagtctctgggtgtactttgatatcgcctaattgttcgtcatgcaggtgcgcctgattggttattgtgttgagaattgcttatttcttgtctatgaatttattgacaatggaaacctaagtcagcatctccaaaggactggtaattgtttgtttgaatgcactctaagtacaatgagattatatcctaatgatttctgtgaattattcagcacgtgcatttgtctataggttatgcgcctctctcatgggctaccagagtgcaaattgccctagactcagcacgtggtcttgagtaccttcatgaacatgttgttccagtatatgttcatagggatatcaagtctgcaaatatcctattagacaaggacttccgggcaaaggttagaattgttcatgaaactctatgttggcctcttatcttcaatactcaatttcttgtttgaagaaagggtgaagggcatcacctctttcatttataggagatgcatgaaatacagaaacgcaagtttgttgttatcctgagaatatatgtaggaagaactacttatcttttatttaagaaaaactaaaacaagggtgtttctcctctatgattaaaagaatgatctcctctaagttaatttttttctccttggaaaattcttcagttctgagctttccatatcttccaactaggctggatcaccaacctgttgaaaccatgccagtctcccctttggacaaatctgggggctgtttaacacctcattggttcttgatgttgtatagctggcatgtttagggaatctctgagctttgaccacacctgcaatatatagggacacattttagcgatgtttgttgctgtttcctccacacccccataaagtttttaccatgcagattgctgattttggactagcaaaacttacagaagttggaagtatgtcgcagtcactgtcaacacgagttgctggtacatttggttacatgcctccagagtaagtgcttgtagtctctctttatttttttctgtgtactaactgacgcatataataggccatacatcatatatcatttataggcttatagcactatctgctatactgatacctatttgcaactagtacagtttagcaccaaagttgtatatggtttacttcccttttttttttttgaacgaactggctaaaaaaagtatagaaattaattatgagctccttgtgtttaagggtccacattgctgactcttccttgatttttgcaaatagagtgatcacttatagctccttgtgttggaaaattctgacaatatttttcagagctcgatatggtgaggtttctcctaaggtggatgtctatgcttttggtgtcgtcctttatgaacttctttcagccaaacaagctattgtgagatcaagtgaatctgttagcgaatcaaaaggactggttttcctggtaatatttttcctgctatcaaattgctgtttttcctgttgtcacttgtaaatgttaaccagaattcatgccatgtgctacaattaaatactcagatcaataaatttaccatccttcttccaatagaaaagtaatttcgttatcagtgtatgtaactacgccgatttgattcattaccaaatgttgtgaataagcttgctaatctctcctgttgatctgtgctccaaacctatttttccgtctaaatttgtctgagtggtgatgaaattctaatggtcagcagaatcaaggattgcctcattttgccagaaatcttgcctgaaccatcataacataagtgcatttgtaggatttgaactatccatggaattgtaacacccatactagttactaccatgtatgaaacgctgacgtgcagaaattctcaaagttatggaagatttatgtgtactcgcaactgtatgaactggattgaaaccaggatcttattgttgattgtatcttccacagtttgaggaggccctcagcgctccaaaccccacggaagctcttgacgaactgattgatccgagcctgcaaggggactaccccgtcgactcggctctcaaggttagtagcagggaagtcagttcgtcagcttccgtttgcttctccagcaaatccaacatgatttgcattgacatgtgctatggtttgattgatttctgaaccagattgcgtcccttgcaaagtcctgcacgcatgaggagcccgggatgaggcctaccatgagatccgtcgtcgttgccctgatggcgctcacagccaacaccgatcttcgcgacatggactaccaccctttctgaggacaggttaactggaccaagtgtaaaaatgtaaagtgatgtgtaaaaatgtgcagttagtcacttgatggatgcatatcccatttaattgtaggcaaaatttgggtacctgaggaaagcaaaacagaagaatagtttcctgtaattgttttcctctctgattcagtgaaaatatacaagcgt</dnaseqindica> |
| External Link(s) |
