Difference between revisions of "Os09g0511000"

From RiceWiki
Jump to: navigation, search
Line 2: Line 2:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
−
=== '' OsCERK1 ''encoded a receptor-like kinase called OsCERK1 ===
+
==== '' OsCERK1 ''encoded a receptor-like kinase called OsCERK1====
−
:: ''OsCERK1'' encoded a receptor-like kinase consisting of 624 amino acid residues, containing a signal peptide, an extracellular domain, a transmembrane region and an intracellular Ser/Thr kinase domain (Figure 1). [[File:F 1.png|thumb|Figure 1 Amino acid sequence of OsCERK1 predicted from the cDNA. Underlining indicates the sequence corresponding to the LysM motif. EC, extracellular domain; IC, intracellular domain; SP, signal peptide; TM, transmembrane domain.]] OsCERK1 is a plasma membrane protein containing one LysM motif in the extracellular domain and an intracellular Ser/Thr kinase domain. <ref name=ref 1/>
+
''OsCERK1'' encoded a receptor-like kinase consisting of 624 amino acid residues, containing a signal peptide, an extracellular domain, a transmembrane region and an intracellular Ser/Thr kinase domain (Figure 1). [[File:F 1.png|thumb|Figure 1 Amino acid sequence of OsCERK1 predicted from the cDNA. Underlining indicates the sequence corresponding to the LysM motif. EC, extracellular domain; IC, intracellular domain; SP, signal peptide; TM, transmembrane domain.]] OsCERK1 is a plasma membrane protein containing one LysM motif in the extracellular domain and an intracellular Ser/Thr kinase domain. <ref name="ref 1" />
−
=== OsCERK1 is essential for chitin elicitor signaling in rice cells ===
+
====OsCERK1 is essential for chitin elicitor signaling in rice cells====
−
:: Knockdown of ''OsCERK1'' resulted in a marked suppression of the defense responses in rice cells induced by chitin oligosaccharides, indicating a central role for OsCERK1 in chitin signaling in rice. The results of yeast two-hybrid assay indicate that the extracellular domain of OsCERK1 can interact with that of CEBiP, suggesting that OsCERK1 and CEBiP have the potential to form homo- and hetero-oligomers through interaction of their LysM-containing extracellular domains. <ref name=ref 1/>
+
Knockdown of ''OsCERK1'' resulted in a marked suppression of the defense responses in rice cells induced by chitin oligosaccharides, indicating a central role for OsCERK1 in chitin signaling in rice. The results of yeast two-hybrid assay indicate that the extracellular domain of OsCERK1 can interact with that of CEBiP, suggesting that OsCERK1 and CEBiP have the potential to form homo- and hetero-oligomers through interaction of their LysM-containing extracellular domains. <"ref name="ref 1" />
−
:: These results indicated that, in the absence of chitin oligosaccharide elicitor, a major portion of CEBiP exists most likely as homo-oligomers in the plasma membrane, whereas OsCERK1 is mostly present as a monomer. However, when the chitin oligosaccharide elicitor is added to the cells, a portion of CEBiP and OsCERK1 appear to form a hetero-oligomer receptor complex. <ref name=ref 1/>
+
These results indicated that, in the absence of chitin oligosaccharide elicitor, a major portion of CEBiP exists most likely as homo-oligomers in the plasma membrane, whereas OsCERK1 is mostly present as a monomer. However, when the chitin oligosaccharide elicitor is added to the cells, a portion of CEBiP and OsCERK1 appear to form a hetero-oligomer receptor complex. <ref name="ref 1" />
−
:: Other researchers also confirm that these two proteins form a receptor complex that transduces the chitin signal to downstream components for immune responses. </ref name=ref 2> </ref name=ref 3> </ref name=ref 4>  
+
Other researchers also confirm that these two proteins form a receptor complex that transduces the chitin signal to downstream components for immune responses. <ref name="ref 2" /> <ref name="ref 3" /> <ref name="ref 4" />  
−
===OsCERK1 signal pathway ===
+
====OsCERK1 signal pathway====
−
:: OsRacGEF1 as a guanine nucleotide exchange factor for OsRac1 (rice small GTPase). OsRacGEF1 interacts with OsCERK1 and is activated when its C-terminal S549 is phosphorylated by the cytoplasmic domain of OsCERK1 in response to chitin. Activated OsRacGEF1 is required for chitin-driven immune responses and resistance to rice blast fungus infection. Further, a protein complex including OsCERK1 and OsRacGEF1 is transported from the endoplasmic reticulum to the PM. OsCEBiP, OsCERK1, OsRacGEF1, and OsRac1 function as key components of a ‘‘defensome’’ critically engaged early during chitin-induced immunity. <ref name=ref 6>
+
OsRacGEF1 as a guanine nucleotide exchange factor for OsRac1 (rice small GTPase). OsRacGEF1 interacts with OsCERK1 and is activated when its C-terminal S549 is phosphorylated by the cytoplasmic domain of OsCERK1 in response to chitin. Activated OsRacGEF1 is required for chitin-driven immune responses and resistance to rice blast fungus infection. Further, a protein complex including OsCERK1 and OsRacGEF1 is transported from the endoplasmic reticulum to the PM. OsCEBiP, OsCERK1, OsRacGEF1, and OsRac1 function as key components of a ‘‘defensome’’ critically engaged early during chitin-induced immunity. <ref name="ref 6" />
  
  
 
===Expression===
 
===Expression===
 
[[File:F 2.png|thumb|Figure 2 Expression patterns of the ''OsCERK1'' gene in each part of the rice plant. Sh, shoot; R, root; PS, proximal shoot; St, stem; F, flower]]
 
[[File:F 2.png|thumb|Figure 2 Expression patterns of the ''OsCERK1'' gene in each part of the rice plant. Sh, shoot; R, root; PS, proximal shoot; St, stem; F, flower]]
−
:: ''OsCERK1'' was expressed in all tissues tested, with weak expression in the flowers (Figure 2). <ref name=ref 1/>
+
''OsCERK1'' was expressed in all tissues tested, with weak expression in the flowers (Figure 2). <ref name="ref 1" />
  
  
 
===Evolution===
 
===Evolution===
−
:: Phylogenies were analyzed by multiple sequence alignment of the protein sequences of the LysM receptor-like kinases. The names of proteins described previously (Zhang et al., 2007) </ref name=ref 2> are shown in parentheses for ease of comparison. [[File:F 3.png|thumb|Figure 3 Phylogenetic tree of OsCERK1 and related plant LysM receptor-like kinases.]] The scale indicates the base substitution rate, and numbers at the nodes represent bootstrap values with 1000 replicates (Figure 3). <ref name=ref 1/>
+
Phylogenies were analyzed by multiple sequence alignment of the protein sequences of the LysM receptor-like kinases. The names of proteins described previously (Zhang et al., 2007) <ref name="ref 5" /> are shown in parentheses for ease of comparison. [[File:F 3.png|thumb|Figure 3 Phylogenetic tree of OsCERK1 and related plant LysM receptor-like kinases.]] The scale indicates the base substitution rate, and numbers at the nodes represent bootstrap values with 1000 replicates (Figure 3). <ref name="ref 1" />
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
−
Department of Life Sciences, Faculty of Agriculture, Meiji University, 1-1-1 Higashi-Mita, Tama-ku, Kawasaki, Kanagawa 214-8571, Japan
+
* Department of Life Sciences, Faculty of Agriculture, Meiji University, 1-1-1 Higashi-Mita, Tama-ku, Kawasaki, Kanagawa 214-8571, Japan
−
Division of Plant Sciences, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
+
* Division of Plant Sciences, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
−
Biotechnology Research Center, The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657, Japan
+
* Biotechnology Research Center, The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657, Japan
−
Laboratory of Plant Molecular Genetics, Graduate School of Biological Sciences, Nara Institute of Science and Technology, 8916-5 Takayama, Ikoma, Nara 630-0192, Japan
+
* Laboratory of Plant Molecular Genetics, Graduate School of Biological Sciences, Nara Institute of Science and Technology, 8916-5 Takayama, Ikoma, Nara 630-0192, Japan
−
Agricultural and Veterinary Research Laboratories, Meiji Seika Kaisha, Kohoku-ku, Yokohama 222–8567, Japan
+
* Agricultural and Veterinary Research Laboratories, Meiji Seika Kaisha, Kohoku-ku, Yokohama 222–8567, Japan
  
  
 
==References==
 
==References==
 
<references>
 
<references>
−
<ref name=ref 1> Takeo Shimizu, Takuto Nakano and Daisuke Takamizawa et al. (2010) Two LysM receptor molecules, CEBiP and OsCERK1, cooperatively regulate chitin elicitor signaling in rice. The Plant Journal, 64, 204–214 </ref>
+
<ref name="ref 1">  
−
</ref name=ref 2> Kaku, H., Nishizawa, Y., Ishii-Minami, N., Akimoto-Tomiyama, C., Dohmae, N., Takio, K., Minami, E., and Shibuya, N. (2006). Plant cells recognize chitin fragments for defense signaling through a plasma membrane receptor. Proc. Natl. Acad. Sci. USA103, 11086–11091. </ref>
+
Takeo Shimizu, Takuto Nakano and Daisuke Takamizawa et al. (2010) Two LysM receptor molecules, CEBiP and OsCERK1, cooperatively regulate chitin elicitor signaling in rice. The Plant Journal, 64, 204–214  
−
<ref name=ref 3> Shimizu, T., Nakano, T., Takamizawa, D., Desaki, Y., Ishii-Minami, N., Nishizawa, Y., Minami, E., Okada, K., Yamane, H., Kaku, H., and Shibuya, N. (2010). Two LysM receptor molecules, CEBiP and OsCERK1, cooperatively regulate chitin elicitor signaling in rice. Plant J.64, 204–214. </ref>
+
</ref>
−
<ref name=ref 4> Shinya, T., Motoyama, N., Ikeda, A., Wada, M., Kamiya, K., Hayafune, M., Kaku, H., and Shibuya, N. (2012). Functional characterization of CEBiP and CERK1 homologs in arabidopsis and rice reveals the presence of different chitin receptor systems in plants. Plant Cell Physiol.53, 1696–1706. </ref>
+
</ref name="ref 2">  
−
<ref name=ref 5> Zhang, X.C., Wu, X., Findley, S., Wan, J., Libault, M., Nguyen, H.T., Cannon, S.B. and Stacey, G. (2007) Molecular evolution of lysin motif-type receptorlike kinases in plants. Plant Physiol.144, 623–636. </ref>
+
Kaku, H., Nishizawa, Y., Ishii-Minami, N., Akimoto-Tomiyama, C., Dohmae, N., Takio, K., Minami, E., and Shibuya, N. (2006). Plant cells recognize chitin fragments for defense signaling through a plasma membrane receptor. Proc. Natl. Acad. Sci. USA103, 11086–11091.  
−
<ref name=ref 6> Akira Akamatsu, Hann Lin Wong and Masayuki Fujiwara et al. (2013) An OsCEBiP/OsCERK1-OsRacGEF1-OsRac1 Module Is an Essential Early Component of Chitin-Induced Rice Immunity. Cell Host & Microbe 13, 465–476 </ref>
+
</ref>
 +
<ref name="ref 3">  
 +
Shimizu, T., Nakano, T., Takamizawa, D., Desaki, Y., Ishii-Minami, N., Nishizawa, Y., Minami, E., Okada, K., Yamane, H., Kaku, H., and Shibuya, N. (2010). Two LysM receptor molecules, CEBiP and OsCERK1, cooperatively regulate chitin elicitor signaling in rice. Plant J.64, 204–214.  
 +
</ref>
 +
<ref name="ref 4">  
 +
Shinya, T., Motoyama, N., Ikeda, A., Wada, M., Kamiya, K., Hayafune, M., Kaku, H., and Shibuya, N. (2012). Functional characterization of CEBiP and CERK1 homologs in arabidopsis and rice reveals the presence of different chitin receptor systems in plants. Plant Cell Physiol.53, 1696–1706.  
 +
</ref>
 +
<ref name="ref 5">  
 +
Zhang, X.C., Wu, X., Findley, S., Wan, J., Libault, M., Nguyen, H.T., Cannon, S.B. and Stacey, G. (2007) Molecular evolution of lysin motif-type receptorlike kinases in plants. Plant Physiol.144, 623–636.  
 +
</ref>
 +
<ref name="ref 6">  
 +
Akira Akamatsu, Hann Lin Wong and Masayuki Fujiwara et al. (2013) An OsCEBiP/OsCERK1-OsRacGEF1-OsRac1 Module Is an Essential Early Component of Chitin-Induced Rice Immunity. Cell Host & Microbe 13, 465–476  
 +
</ref>
 
</references>
 
</references>
  

Revision as of 11:30, 3 June 2014

The rice gene Os09g0511000 is known as OsCERK1. OsCERK1 encodes a receptor-like kinase called OsCERK1 which is essential for chitin elicitor signaling in rice cells.

Annotated Information

Function

OsCERK1 encoded a receptor-like kinase called OsCERK1

OsCERK1 encoded a receptor-like kinase consisting of 624 amino acid residues, containing a signal peptide, an extracellular domain, a transmembrane region and an intracellular Ser/Thr kinase domain (Figure 1).
Figure 1 Amino acid sequence of OsCERK1 predicted from the cDNA. Underlining indicates the sequence corresponding to the LysM motif. EC, extracellular domain; IC, intracellular domain; SP, signal peptide; TM, transmembrane domain.
OsCERK1 is a plasma membrane protein containing one LysM motif in the extracellular domain and an intracellular Ser/Thr kinase domain. [1]

OsCERK1 is essential for chitin elicitor signaling in rice cells

Knockdown of OsCERK1 resulted in a marked suppression of the defense responses in rice cells induced by chitin oligosaccharides, indicating a central role for OsCERK1 in chitin signaling in rice. The results of yeast two-hybrid assay indicate that the extracellular domain of OsCERK1 can interact with that of CEBiP, suggesting that OsCERK1 and CEBiP have the potential to form homo- and hetero-oligomers through interaction of their LysM-containing extracellular domains. <"ref name="ref 1" /> These results indicated that, in the absence of chitin oligosaccharide elicitor, a major portion of CEBiP exists most likely as homo-oligomers in the plasma membrane, whereas OsCERK1 is mostly present as a monomer. However, when the chitin oligosaccharide elicitor is added to the cells, a portion of CEBiP and OsCERK1 appear to form a hetero-oligomer receptor complex. [1] Other researchers also confirm that these two proteins form a receptor complex that transduces the chitin signal to downstream components for immune responses. [2] [3] [4]

OsCERK1 signal pathway

OsRacGEF1 as a guanine nucleotide exchange factor for OsRac1 (rice small GTPase). OsRacGEF1 interacts with OsCERK1 and is activated when its C-terminal S549 is phosphorylated by the cytoplasmic domain of OsCERK1 in response to chitin. Activated OsRacGEF1 is required for chitin-driven immune responses and resistance to rice blast fungus infection. Further, a protein complex including OsCERK1 and OsRacGEF1 is transported from the endoplasmic reticulum to the PM. OsCEBiP, OsCERK1, OsRacGEF1, and OsRac1 function as key components of a ‘‘defensome’’ critically engaged early during chitin-induced immunity. [5]


Expression

Figure 2 Expression patterns of the OsCERK1 gene in each part of the rice plant. Sh, shoot; R, root; PS, proximal shoot; St, stem; F, flower

OsCERK1 was expressed in all tissues tested, with weak expression in the flowers (Figure 2). [1]


Evolution

Phylogenies were analyzed by multiple sequence alignment of the protein sequences of the LysM receptor-like kinases. The names of proteins described previously (Zhang et al., 2007) [6] are shown in parentheses for ease of comparison.
Figure 3 Phylogenetic tree of OsCERK1 and related plant LysM receptor-like kinases.
The scale indicates the base substitution rate, and numbers at the nodes represent bootstrap values with 1000 replicates (Figure 3). [1]

You can also add sub-section(s) at will.

Labs working on this gene

  • Department of Life Sciences, Faculty of Agriculture, Meiji University, 1-1-1 Higashi-Mita, Tama-ku, Kawasaki, Kanagawa 214-8571, Japan
  • Division of Plant Sciences, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan
  • Biotechnology Research Center, The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657, Japan
  • Laboratory of Plant Molecular Genetics, Graduate School of Biological Sciences, Nara Institute of Science and Technology, 8916-5 Takayama, Ikoma, Nara 630-0192, Japan
  • Agricultural and Veterinary Research Laboratories, Meiji Seika Kaisha, Kohoku-ku, Yokohama 222–8567, Japan


References

  1. ↑ 1.0 1.1 1.2 1.3 Takeo Shimizu, Takuto Nakano and Daisuke Takamizawa et al. (2010) Two LysM receptor molecules, CEBiP and OsCERK1, cooperatively regulate chitin elicitor signaling in rice. The Plant Journal, 64, 204–214
  2. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref_2
  3. ↑ Shimizu, T., Nakano, T., Takamizawa, D., Desaki, Y., Ishii-Minami, N., Nishizawa, Y., Minami, E., Okada, K., Yamane, H., Kaku, H., and Shibuya, N. (2010). Two LysM receptor molecules, CEBiP and OsCERK1, cooperatively regulate chitin elicitor signaling in rice. Plant J.64, 204–214.
  4. ↑ Shinya, T., Motoyama, N., Ikeda, A., Wada, M., Kamiya, K., Hayafune, M., Kaku, H., and Shibuya, N. (2012). Functional characterization of CEBiP and CERK1 homologs in arabidopsis and rice reveals the presence of different chitin receptor systems in plants. Plant Cell Physiol.53, 1696–1706.
  5. ↑ Akira Akamatsu, Hann Lin Wong and Masayuki Fujiwara et al. (2013) An OsCEBiP/OsCERK1-OsRacGEF1-OsRac1 Module Is an Essential Early Component of Chitin-Induced Rice Immunity. Cell Host & Microbe 13, 465–476
  6. ↑ Zhang, X.C., Wu, X., Findley, S., Wan, J., Libault, M., Nguyen, H.T., Cannon, S.B. and Stacey, G. (2007) Molecular evolution of lysin motif-type receptorlike kinases in plants. Plant Physiol.144, 623–636.


Structured Information

Gene Name

Os09g0511000

Description

Conserved hypothetical protein

Version

NM_001189005.1 GI:297727140 GeneID:9270778

Length

5016 bp

Definition

Oryza sativa Japonica Group Os09g0511000, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:20514905..20519920

Sequence Coding Region

20515369..20515559,20516273..20516306,20516496..20516531

Expression

GEO Profiles:Os09g0511000

Genome Context

<gbrowseImage1> name=NC_008402:20514905..20519920 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:20514905..20519920 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcggcgacgagagggtctcgccgcggtacgggctgttcctcacctacccgctctgggacggggagacgctcgaatcggtggccgcgcagtacgggttctcgtcgccggcggagatggagctgatcaggaggtacaaccccgggatgggaggggtctccgggaaggggattgtgttcatcccggtgaaagatccaaatggaagttaccaccctctgaaatcagggtggaatggggaatagcctttctggaggagcgatag</cdnaseq>

Protein Sequence

<aaseq>MRRREGLAAVRAVPHLPALGRGDARIGGRAVRVLVAGGDGADQE VQPRDGRGLREGDCVHPGERSKWKLPPSEIRVEWGIAFLEER</aaseq>

Gene Sequence

<dnaseqindica>465..655#1369..1402#1592..1627#gccctcctcatcggcgcctgtgccttcgcggcggcggcggttgcggcgtccggcgacggttgccgcgccggctgctcgctggccatcgccgcctactacttctccgagggttcaaacctcaccttcatcgccaccatcttcgccatcggcggcggcggctaccaagcgctgctcccctacaacccggccatcaccaacccggactacgtcgtcaccggcgaccgcgtgctcgttcccttcccctgctcctgcctcgggctccccgccgcgcccgcctccaccttcctcgcaggcgccatcccctacccgctccccctcccccgcggcggcggcgacacctacgacgccgtcgccgccaactacgccgacctcaccaccgccgcgtggctggaggccaccaacgcgtacccgccggggaggatccccggcggcgatgggagggtcaacgtcaccatcaactgctcatgcggcgacgagagggtctcgccgcggtacgggctgttcctcacctacccgctctgggacggggagacgctcgaatcggtggccgcgcagtacgggttctcgtcgccggcggagatggagctgatcaggaggtacaaccccgggatgggaggggtctccgggaaggggattgtgttcatcccggtgaaaggtgagtgctactggtttctcagtttgattttgactgttttagcttgtaactgtgagttgcgagaggttttggatgataattgagcatgtgaaaaatgtgaaatgtgaagtgcggtttggattacagtggtttttgcaggtagtttgtgaaaggaagtttggttactgcttgaatgttcttagcatatttatcaatgattggaacttctgagctatgtgcttcttcttttttgctctgctgtccaattttgcttggttgtatttgtgattgatttaaagcaatgcagtaactgagttttggttatacaaagtttaacccctgtcgtatgctatttcacatacacagatcgactttgtgccatggtatgcagtagttttcatgtttcgggagtggtaatctatttgatcctgcatcatggttgtttgaggcatcatgaactcatgtctatgctacatagttggtacaatggtaccggagagagtatcatgcaagtcgaattgccacccttttttttactgatacttgataattagttagttagcataaccagataattaacacaactaactgcaatcattcttcagaaaagctcaccactgtcatttgcttaatctcttctcttaaaaaacagctgttgtcaacaattaatcttctaggtgtcaatctataattctatatatgctaacatcctttactctgttatttatttccagatccaaatggaagttaccaccctctgaaatcagggtaagcattcttcgactgtcaggtgaaattacaactgtgatttcctttattattttctgatatgtatttcttgtgcagtgtaggcattgttcttctcttctgtgagctcttgtgtatctatgctaaggttatcaagaactaaagtgggtattgtcatgaaacactgatgttcaactcacattcttctaggtggaatggggaatagcctttctggaggagcgatagcaggaattgtgatagcttgcattgctattttcattgtggccatatggttgattatcatgttctataggtggcaaaagttcaggaaggccacatcgcgtccatctccagaagaaaccagccaccttggtaatgataaacctcctttcttggctgtaacactcctctagatcaactatgccaaactgttgaacatattacatgctttgtaaagtgcttctgttgtgattttggtatatcagctgctattatttgtgtggtaagtagcttagctagtcttctttttatcattgtacaaactgtatgatttctctgcaaatgctacaactcaaaattaatatgccttgtcaattacagatgatgcttcccaagctgaaggcattaaggttgagagatccatagaattctcatatgaagagatttttaatgcaacacagggattttctatggaacataaaattgggcaaggtggttttggttcagtgtattatgctgagcttagaggcgaggttggttcaacatttttctcatcatggacaacctatcagagtgcattcacacataaatcaataaggaggacacaacattttgatgtgcattcttctatcaatttgaaatgacttctctgctgccttcagaaaactgccataaagaaaatgggcatgcaagcaactcaagaattccttgctgaactgaaggtcttgacacatgttcaccacttgaatctggtgggtggtcttatgattttctgtaataatataacagaaataatctcaactaccaactgaactttacattttgctatgcttacttacagaacgagaagataaactttgattagagtttagtaaagaccataatacctttcaatagggcacggcatcatatttttcatgttggaatagtactctcgagtctctgtactcgagtctctgggtgtactttgatatcgcctaattgttcgtcatgcaggtgcgcctgattggttattgtgttgagaattgcttatttcttgtctatgaatttattgacaatggaaacctaagtcagcatctccaaaggactggtaattgtttgtttgaatgcactctaagtacaatgagattatatcctaatgatttctgtgaattattcagcacgtgcatttgtctataggttatgcgcctctctcatgggctaccagagtgcaaattgccctagactcagcacgtggtcttgagtaccttcatgaacatgttgttccagtatatgttcatagggatatcaagtctgcaaatatcctattagacaaggacttccgggcaaaggttagaattgttcatgaaactctatgttggcctcttatcttcaatactcaatttcttgtttgaagaaagggtgaagggcatcacctctttcatttataggagatgcatgaaatacagaaacgcaagtttgttgttatcctgagaatatatgtaggaagaactacttatcttttatttaagaaaaactaaaacaagggtgtttctcctctatgattaaaagaatgatctcctctaagttaatttttttctccttggaaaattcttcagttctgagctttccatatcttccaactaggctggatcaccaacctgttgaaaccatgccagtctcccctttggacaaatctgggggctgtttaacacctcattggttcttgatgttgtatagctggcatgtttagggaatctctgagctttgaccacacctgcaatatatagggacacattttagcgatgtttgttgctgtttcctccacacccccataaagtttttaccatgcagattgctgattttggactagcaaaacttacagaagttggaagtatgtcgcagtcactgtcaacacgagttgctggtacatttggttacatgcctccagagtaagtgcttgtagtctctctttatttttttctgtgtactaactgacgcatataataggccatacatcatatatcatttataggcttatagcactatctgctatactgatacctatttgcaactagtacagtttagcaccaaagttgtatatggtttacttcccttttttttttttgaacgaactggctaaaaaaagtatagaaattaattatgagctccttgtgtttaagggtccacattgctgactcttccttgatttttgcaaatagagtgatcacttatagctccttgtgttggaaaattctgacaatatttttcagagctcgatatggtgaggtttctcctaaggtggatgtctatgcttttggtgtcgtcctttatgaacttctttcagccaaacaagctattgtgagatcaagtgaatctgttagcgaatcaaaaggactggttttcctggtaatatttttcctgctatcaaattgctgtttttcctgttgtcacttgtaaatgttaaccagaattcatgccatgtgctacaattaaatactcagatcaataaatttaccatccttcttccaatagaaaagtaatttcgttatcagtgtatgtaactacgccgatttgattcattaccaaatgttgtgaataagcttgctaatctctcctgttgatctgtgctccaaacctatttttccgtctaaatttgtctgagtggtgatgaaattctaatggtcagcagaatcaaggattgcctcattttgccagaaatcttgcctgaaccatcataacataagtgcatttgtaggatttgaactatccatggaattgtaacacccatactagttactaccatgtatgaaacgctgacgtgcagaaattctcaaagttatggaagatttatgtgtactcgcaactgtatgaactggattgaaaccaggatcttattgttgattgtatcttccacagtttgaggaggccctcagcgctccaaaccccacggaagctcttgacgaactgattgatccgagcctgcaaggggactaccccgtcgactcggctctcaaggttagtagcagggaagtcagttcgtcagcttccgtttgcttctccagcaaatccaacatgatttgcattgacatgtgctatggtttgattgatttctgaaccagattgcgtcccttgcaaagtcctgcacgcatgaggagcccgggatgaggcctaccatgagatccgtcgtcgttgccctgatggcgctcacagccaacaccgatcttcgcgacatggactaccaccctttctgaggacaggttaactggaccaagtgtaaaaatgtaaagtgatgtgtaaaaatgtgcagttagtcacttgatggatgcatatcccatttaattgtaggcaaaatttgggtacctgaggaaagcaaaacagaagaatagtttcctgtaattgttttcctctctgattcagtgaaaatatacaagcgt</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0511000, RefSeq:Os09g0511000

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0511000&oldid=176718"