Difference between revisions of "Os03g0150200"
(→Annotated Information) |
|||
| Line 4: | Line 4: | ||
===Function=== | ===Function=== | ||
Please input function information here. | Please input function information here. | ||
| − | + | This gene was isolated using the yeast-one-hybrid system. The screened cDNA was named OsAP23 (GenBank accession number: AY339376). The sequencing results indicated that OsAP23 contained a 426-bp open reading frame (ORF) and encoded a 141-amino-acid protein (Supplementary Fig. 1). The OsAP23 gene was located on rice chromosome number 3. This gene encodes the GCC-box binding protein. | |
| + | To investigate the putative role of OsAP23 in response to abiotic stress, the OsAP23 gene was over-expressed under the control of the CaMV 35S promoter in transgenic Arabidopsis plants.The growth of the transgenic and wild-type plants was similar when subjected to cold, heat, or drought stress. But the germination of the transgenic Arabidopsis plants that overexpress the OsAP23 gene became more severely inhibited as the NaCl concentration increased. The germination rates were much lower on MS media containing 150 mM NaCl than on MS medium containing 100 mM NaCl.These results indicated that OsAP23 negatively regulated high salt tolerance, at least during germination and early vegetative growth. | ||
===Expression=== | ===Expression=== | ||
Please input expression information here. | Please input expression information here. | ||
| − | + | To evaluate the over-expression of the OsAP23 gene in transgenic Arabidopsis plants subjected to high salt stress, the expression of several stress-responsive genes in regulated pathways was monitored using semi-quantitative RT-PCR analysis.Before being subjected to high salt conditions, the expression levels of the rd29a, rd29b, and rd22 genes in wild-type Arabidopsis plants were similar to those in the transgenic plants. For the high-salt treatments, 4-week-old seedlings were transferred to solutions containing 250 mM NaCl for 12 h. Although salt stress increased the levels of all the three genes in both groups of Arabidopsis, The expression levels of rd29a, rd29b, and rd22 in the transgenic plants were less than the expression levels recorded in wild-type plants. | |
===Evolution=== | ===Evolution=== | ||
Please input evolution information here. | Please input evolution information here. | ||
| − | + | Sequence analysis revealed that OsAP23 contained a single AP2 DNA-binding domain that comprised 58 amino acids and was located in the N-terminal region of OsAP23. The putative amino acid sequence for the rice OsAP23 protein was compared with known AP2/ERF proteins from Arabidopsis. These proteins shared a high degree of homology in the AP2 DNA-binding domain. In order to classify OsAP23 into a subfamily of the AP2/ERF family, AP2/ERF proteins from Arabidopsis were aligned with OsAP23 to create the phylogenetic tree. The results showed that OsAP23 belonged to the B3 group of the ERF subfamily. | |
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
Revision as of 12:48, 3 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here. This gene was isolated using the yeast-one-hybrid system. The screened cDNA was named OsAP23 (GenBank accession number: AY339376). The sequencing results indicated that OsAP23 contained a 426-bp open reading frame (ORF) and encoded a 141-amino-acid protein (Supplementary Fig. 1). The OsAP23 gene was located on rice chromosome number 3. This gene encodes the GCC-box binding protein. To investigate the putative role of OsAP23 in response to abiotic stress, the OsAP23 gene was over-expressed under the control of the CaMV 35S promoter in transgenic Arabidopsis plants.The growth of the transgenic and wild-type plants was similar when subjected to cold, heat, or drought stress. But the germination of the transgenic Arabidopsis plants that overexpress the OsAP23 gene became more severely inhibited as the NaCl concentration increased. The germination rates were much lower on MS media containing 150 mM NaCl than on MS medium containing 100 mM NaCl.These results indicated that OsAP23 negatively regulated high salt tolerance, at least during germination and early vegetative growth.
Expression
Please input expression information here. To evaluate the over-expression of the OsAP23 gene in transgenic Arabidopsis plants subjected to high salt stress, the expression of several stress-responsive genes in regulated pathways was monitored using semi-quantitative RT-PCR analysis.Before being subjected to high salt conditions, the expression levels of the rd29a, rd29b, and rd22 genes in wild-type Arabidopsis plants were similar to those in the transgenic plants. For the high-salt treatments, 4-week-old seedlings were transferred to solutions containing 250 mM NaCl for 12 h. Although salt stress increased the levels of all the three genes in both groups of Arabidopsis, The expression levels of rd29a, rd29b, and rd22 in the transgenic plants were less than the expression levels recorded in wild-type plants.
Evolution
Please input evolution information here. Sequence analysis revealed that OsAP23 contained a single AP2 DNA-binding domain that comprised 58 amino acids and was located in the N-terminal region of OsAP23. The putative amino acid sequence for the rice OsAP23 protein was compared with known AP2/ERF proteins from Arabidopsis. These proteins shared a high degree of homology in the AP2 DNA-binding domain. In order to classify OsAP23 into a subfamily of the AP2/ERF family, AP2/ERF proteins from Arabidopsis were aligned with OsAP23 to create the phylogenetic tree. The results showed that OsAP23 belonged to the B3 group of the ERF subfamily. You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os03g0150200 |
|---|---|
| Description |
Similar to Ethylene-responsive transcription factor 5 (Ethylene-responsive element binding factor 5 homolog) (EREBP-4) (NtERF4) |
| Version |
NM_001055510.1 GI:115450748 GeneID:4331633 |
| Length |
633 bp |
| Definition |
Oryza sativa Japonica Group Os03g0150200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:2778626..2779258 |
| Sequence Coding Region |
2778674..2779099 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:2778626..2779258 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:2778626..2779258 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggaggacgacaagagtaaggaggggaaatcgtcgtcgtcgtaccgcggcgtgcggaagcggccgtggggcaagttcgcggcggagatccgcgacccggagcgcgggggagcccgcgtgtggctcggcacgttcgacaccgcggaggaggccgcgcgggcgtacgaccgcgccgcattcgccatgaagggcgccacggccatgctcaacttcccgggagatcatcatcacggcgccgcaagcaggatgaccagcaccggctcttcttcgtcctccttcaccacgcctcctccggcgaactcctccgcggcggcgggccgcggcggctccgatcggacgacggacaaggtggagctggagtgcctcgacgacaaggtcctggaggacctcctcgcggagaccaactatcgtgataagaactactag</cdnaseq> |
| Protein Sequence |
<aaseq>MEDDKSKEGKSSSSYRGVRKRPWGKFAAEIRDPERGGARVWLGT FDTAEEAARAYDRAAFAMKGATAMLNFPGDHHHGAASRMTSTGSSSSSFTTPPPANSS AAAGRGGSDRTTDKVELECLDDKVLEDLLAETNYRDKNY</aaseq> |
| Gene Sequence |
<dnaseqindica>49..474#ccaatcggcgtcgtcaggcctctcgcgtgtgcgagcggttgcgtccgcatggaggacgacaagagtaaggaggggaaatcgtcgtcgtcgtaccgcggcgtgcggaagcggccgtggggcaagttcgcggcggagatccgcgacccggagcgcgggggagcccgcgtgtggctcggcacgttcgacaccgcggaggaggccgcgcgggcgtacgaccgcgccgcattcgccatgaagggcgccacggccatgctcaacttcccgggagatcatcatcacggcgccgcaagcaggatgaccagcaccggctcttcttcgtcctccttcaccacgcctcctccggcgaactcctccgcggcggcgggccgcggcggctccgatcggacgacggacaaggtggagctggagtgcctcgacgacaaggtcctggaggacctcctcgcggagaccaactatcgtgataagaactactagctagctagctactatggctacttagctagtacataccgatccgtcggtattagcaagacggacatggagcagtcgtgatctcgtctgtatgcgctccttgaaacgatcgagaccatgagcttgctagctagctacgcatagtagtagcaataacagagg</dnaseqindica> |
| External Link(s) |