Difference between revisions of "Os03g0150200"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(References)
Line 19: Line 19:
 
==References==
 
==References==
 
Please input cited references here.
 
Please input cited references here.
 +
1.Jing Zhuang, Hai-Hua Jiang, Feng Wang, Ri-He Peng, Quan-Hong Yao, Ai-Sheng Xiong. (2013) A rice OsAP23, functioning as an AP2/ERF transcription factor, reduces salt tolerance in transgenic arabidopsis. Plant Mol Biol Rep (2013) 31:1336–1345
  
 
==Structured Information==
 
==Structured Information==

Revision as of 12:58, 3 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. This gene was isolated using the yeast-one-hybrid system. The screened cDNA was named OsAP23 (GenBank accession number: AY339376). The sequencing results indicated that OsAP23 contained a 426-bp open reading frame (ORF) and encoded a 141-amino-acid protein (Supplementary Fig. 1). The OsAP23 gene was located on rice chromosome number 3. This gene encodes the GCC-box binding protein. To investigate the putative role of OsAP23 in response to abiotic stress, the OsAP23 gene was over-expressed under the control of the CaMV 35S promoter in transgenic Arabidopsis plants.The growth of the transgenic and wild-type plants was similar when subjected to cold, heat, or drought stress. But the germination of the transgenic Arabidopsis plants that overexpress the OsAP23 gene became more severely inhibited as the NaCl concentration increased. The germination rates were much lower on MS media containing 150 mM NaCl than on MS medium containing 100 mM NaCl.These results indicated that OsAP23 negatively regulated high salt tolerance, at least during germination and early vegetative growth.

Expression

Please input expression information here. To evaluate the over-expression of the OsAP23 gene in transgenic Arabidopsis plants subjected to high salt stress, the expression of several stress-responsive genes in regulated pathways was monitored using semi-quantitative RT-PCR analysis.Before being subjected to high salt conditions, the expression levels of the rd29a, rd29b, and rd22 genes in wild-type Arabidopsis plants were similar to those in the transgenic plants. For the high-salt treatments, 4-week-old seedlings were transferred to solutions containing 250 mM NaCl for 12 h. Although salt stress increased the levels of all the three genes in both groups of Arabidopsis, The expression levels of rd29a, rd29b, and rd22 in the transgenic plants were less than the expression levels recorded in wild-type plants.

Evolution

Please input evolution information here. Sequence analysis revealed that OsAP23 contained a single AP2 DNA-binding domain that comprised 58 amino acids and was located in the N-terminal region of OsAP23. The putative amino acid sequence for the rice OsAP23 protein was compared with known AP2/ERF proteins from Arabidopsis. These proteins shared a high degree of homology in the AP2 DNA-binding domain. In order to classify OsAP23 into a subfamily of the AP2/ERF family, AP2/ERF proteins from Arabidopsis were aligned with OsAP23 to create the phylogenetic tree. The results showed that OsAP23 belonged to the B3 group of the ERF subfamily. You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here. 1.Jing Zhuang, Hai-Hua Jiang, Feng Wang, Ri-He Peng, Quan-Hong Yao, Ai-Sheng Xiong. (2013) A rice OsAP23, functioning as an AP2/ERF transcription factor, reduces salt tolerance in transgenic arabidopsis. Plant Mol Biol Rep (2013) 31:1336–1345

Structured Information

Gene Name

Os03g0150200

Description

Similar to Ethylene-responsive transcription factor 5 (Ethylene-responsive element binding factor 5 homolog) (EREBP-4) (NtERF4)

Version

NM_001055510.1 GI:115450748 GeneID:4331633

Length

633 bp

Definition

Oryza sativa Japonica Group Os03g0150200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:2778626..2779258

Sequence Coding Region

2778674..2779099

Expression

GEO Profiles:Os03g0150200

Genome Context

<gbrowseImage1> name=NC_008396:2778626..2779258 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:2778626..2779258 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaggacgacaagagtaaggaggggaaatcgtcgtcgtcgtaccgcggcgtgcggaagcggccgtggggcaagttcgcggcggagatccgcgacccggagcgcgggggagcccgcgtgtggctcggcacgttcgacaccgcggaggaggccgcgcgggcgtacgaccgcgccgcattcgccatgaagggcgccacggccatgctcaacttcccgggagatcatcatcacggcgccgcaagcaggatgaccagcaccggctcttcttcgtcctccttcaccacgcctcctccggcgaactcctccgcggcggcgggccgcggcggctccgatcggacgacggacaaggtggagctggagtgcctcgacgacaaggtcctggaggacctcctcgcggagaccaactatcgtgataagaactactag</cdnaseq>

Protein Sequence

<aaseq>MEDDKSKEGKSSSSYRGVRKRPWGKFAAEIRDPERGGARVWLGT FDTAEEAARAYDRAAFAMKGATAMLNFPGDHHHGAASRMTSTGSSSSSFTTPPPANSS AAAGRGGSDRTTDKVELECLDDKVLEDLLAETNYRDKNY</aaseq>

Gene Sequence

<dnaseqindica>49..474#ccaatcggcgtcgtcaggcctctcgcgtgtgcgagcggttgcgtccgcatggaggacgacaagagtaaggaggggaaatcgtcgtcgtcgtaccgcggcgtgcggaagcggccgtggggcaagttcgcggcggagatccgcgacccggagcgcgggggagcccgcgtgtggctcggcacgttcgacaccgcggaggaggccgcgcgggcgtacgaccgcgccgcattcgccatgaagggcgccacggccatgctcaacttcccgggagatcatcatcacggcgccgcaagcaggatgaccagcaccggctcttcttcgtcctccttcaccacgcctcctccggcgaactcctccgcggcggcgggccgcggcggctccgatcggacgacggacaaggtggagctggagtgcctcgacgacaaggtcctggaggacctcctcgcggagaccaactatcgtgataagaactactagctagctagctactatggctacttagctagtacataccgatccgtcggtattagcaagacggacatggagcagtcgtgatctcgtctgtatgcgctccttgaaacgatcgagaccatgagcttgctagctagctacgcatagtagtagcaataacagagg</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0150200, RefSeq:Os03g0150200