Difference between revisions of "Os03g0688300"

From RiceWiki
Jump to: navigation, search
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
This gene also know as OsCPK9 which is  one of calcium-dependent protein kinase genes. It's a member of rice CDPK gene family. OsCPK9 transcription was induced by abscisic acid (ABA), PEG6000, and NaCl treatments. OsCPK9 plays a positive role in drought stress tolerance and spikelet fertility. Physiological analyses revealed that OsCPK9 improves drought stress tolerance by enhancing stomatal closure and by improving the osmotic adjustment ability of the plant. It also improves pollen viability, thereby increasing spikelet fertility<ref name="ref1" />. And expression of OsCPK9 was elevated in seedlings infected by rice blast, indicating that this gene plays an important role in signaling in response to rice blast treatment<ref name="ref2" />.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
Expression of OsCPK9 increased in response to rice blast treatment<ref name="ref2" />.
 +
 
 +
OsCPK9 expression was increased after 12–24 h of both avirulent and virulent rice blast treatment. These results suggest that OsCPK9 is involved in decoding the rice blast-induced Ca2+ signal pathway<ref name="ref2" />.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
OsCPK9  have four  splicing sites, respectively , fewer than the number typical for CDPKs. This finding suggests that intron loss events have occurred within these rice CDPK genes during evolution<ref name="ref2" />.
 +
 
 +
===Knowledge Extension=
 +
 
 +
OsCPK9 gene had GC-rich sequences (66.8%) throughout their coding region<ref name="ref2" />.
 +
 
 +
Overexpression of the AtbZIP60 gene in transgenic cell lines improved salt, drought, and cold stress tolerances by regulating expression of Ca(2+)-dependent protein kinase genes like OsCPK9 <ref name="ref3" />.
  
You can also add sub-section(s) at will.
 
  
==Labs working on this gene==
+
== References ==
Please input related labs here.
+
<references>
 +
<ref name="ref1">Shuya Wei, Wei Hu, et al. (2014) A rice calcium-dependent protein kinase OsCPK9 positively regulates drought stress tolerance and spikelet fertility. BMC Plant Biol 14(1), 133.
 +
<ref name="ref2">Takayuki Asano, Naoki Tanaka, Guangxiao Yang, Nagao Hayashi, and Setsuko Komatsu. (2005) Genome-wide identification of the rice calcium-dependent protein kinase and its closely related kinase gene families: comprehensive analysis of the CDPKs gene family in rice. Plant Cell Physiol 46(2).
 +
<ref name="ref3">Wei Tang and Michael Page. (2013) Transcription factor AtbZIP60 regulates expression of Ca2+ -dependent protein kinase genes in transgenic cells. Mol Biol Rep 40(3), 2723–2732.
  
==References==
 
Please input cited references here.
 
  
 
==Structured Information==
 
==Structured Information==

Revision as of 13:06, 3 June 2014

Please input one-sentence summary here.

Annotated Information

Function

This gene also know as OsCPK9 which is one of calcium-dependent protein kinase genes. It's a member of rice CDPK gene family. OsCPK9 transcription was induced by abscisic acid (ABA), PEG6000, and NaCl treatments. OsCPK9 plays a positive role in drought stress tolerance and spikelet fertility. Physiological analyses revealed that OsCPK9 improves drought stress tolerance by enhancing stomatal closure and by improving the osmotic adjustment ability of the plant. It also improves pollen viability, thereby increasing spikelet fertility[1]. And expression of OsCPK9 was elevated in seedlings infected by rice blast, indicating that this gene plays an important role in signaling in response to rice blast treatment[2].

Expression

Expression of OsCPK9 increased in response to rice blast treatment[2].

OsCPK9 expression was increased after 12–24 h of both avirulent and virulent rice blast treatment. These results suggest that OsCPK9 is involved in decoding the rice blast-induced Ca2+ signal pathway[2].

Evolution

OsCPK9 have four splicing sites, respectively , fewer than the number typical for CDPKs. This finding suggests that intron loss events have occurred within these rice CDPK genes during evolution[2].

==Knowledge Extension

OsCPK9 gene had GC-rich sequences (66.8%) throughout their coding region[2].

Overexpression of the AtbZIP60 gene in transgenic cell lines improved salt, drought, and cold stress tolerances by regulating expression of Ca(2+)-dependent protein kinase genes like OsCPK9 [3].


References

<references> <ref name="ref1">Shuya Wei, Wei Hu, et al. (2014) A rice calcium-dependent protein kinase OsCPK9 positively regulates drought stress tolerance and spikelet fertility. BMC Plant Biol 14(1), 133. <ref name="ref2">Takayuki Asano, Naoki Tanaka, Guangxiao Yang, Nagao Hayashi, and Setsuko Komatsu. (2005) Genome-wide identification of the rice calcium-dependent protein kinase and its closely related kinase gene families: comprehensive analysis of the CDPKs gene family in rice. Plant Cell Physiol 46(2). <ref name="ref3">Wei Tang and Michael Page. (2013) Transcription factor AtbZIP60 regulates expression of Ca2+ -dependent protein kinase genes in transgenic cells. Mol Biol Rep 40(3), 2723–2732.


Structured Information

Gene Name

Os03g0688300

Description

Similar to Calcium-dependent protein kinase

Version

NM_001057479.1 GI:115454686 GeneID:4333767

Length

5334 bp

Definition

Oryza sativa Japonica Group Os03g0688300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:28227842..28233175

Sequence Coding Region

28227980..28228745,28231487..28231899,28231987..28232154,28232224..28232454,28232731..28232877

Expression

GEO Profiles:Os03g0688300

Genome Context

<gbrowseImage1> name=NC_008396:28227842..28233175 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:28227842..28233175 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggcaacacgtgctgcgtcgctccggctaccaccgatgaggtgggcgcgccgccgcgagatcatcatcacgcggccaagaagtcgccggcgccgtcggcgacgacgacgacggcgacgaggcagaggcatggccaagaacccaagcccaagcccaagcccagggcgagggcgaagcccaacccgtacgactgggcgccgccgcgggtgctgccggcgaggggcggcgccgccgcgtccgcggtgcgcgtgctggagggcgtggtgccgcaccacccgcggctgcgcgtcacggacaagtaccagctcggccgcgagctggggcgcggcgagttcggggtgacgcacctcgccacggaccgcgcgacgcgggagcggctggcgtgcaagtccatcccgaagcgccgcctccgcaccgccgtggacgtcgccgacgtgcggcgcgaggtggccatcatggcgtcgctcccggaccacccggcgctggtgcgcctccgcgccgcctacgaggacgccgacgcggtgcacctggtgatggagctctgcgacggcggcgagctgttcgaccggatcgtggcgaggggccggtacacggagcgcgccgcggccgccgcggcgcggacggtggcggaggtggtgcgcgcgtgccacgcccacggcgtgatgcaccgcgacctcaagccggagaacttcctctacgccggcaaggccgaggacgcgcagctcaaggccatcgatttcggcctctccgtcttcttccgacctggggagaggttcagggagatcgtggggagcccgtactacatggcgccggaggtgctccggcgagactacggcccggaggtggacatctggtccgccggcgtcatcctctacatcctcctgtgcggcgtcccgccgttctgggccgagacggagcagggcgtggcgcgcgccatcctccgcggcgccgccgacttcgaccgggagccatggccgcgcatctcccgcgccgccaagtccctcgtccgccagatgctcgacgtggacccgcgccgccgccccacggcgcagcaggtgctcgaccacccctggctccaccacgccgcccgcgcccccaacgtccccctcggcgacgtcgtccgcgcccgcctcaagcagttctccctcatgaaccgcctcaagaagaaggccatgcgggtgatcgcggaacacctgtcggtagaggaggtggaggtgatcaaggacatgttcgcgctcatggacaccgacaacaacggcagggtcacgctccaggagctcaaggacggcctcaccaaggtcggctccaagctcgccgagcccgagatggagcttctcatggaggccgcggatgtggatggcaatgggtacctggactacggcgagttcgtggcggtgaccatccacctgcagcgcctctccaacgacaaccacctccgcacggccttcctcttcttcgacaaggacggcagcggctacatcgaccgcgccgagctcgccgacgccctcgccgacgactccggccacgccgacgacgccgtgctcgaccacatccttagagaagtcgacaccgacaaggatgggcggatcagctacgaggagttcgtggcgatgatgaaatccgggacggattggaggaaggcgtcgcggcaatactcgagggagcggttcaagacgctcagcaacagcctcatcaaggacggctcgatcaccatggcgcgctag</cdnaseq>

Protein Sequence

<aaseq>MGNTCCVAPATTDEVGAPPRDHHHAAKKSPAPSATTTTATRQRH GQEPKPKPKPRARAKPNPYDWAPPRVLPARGGAAASAVRVLEGVVPHHPRLRVTDKYQ LGRELGRGEFGVTHLATDRATRERLACKSIPKRRLRTAVDVADVRREVAIMASLPDHP ALVRLRAAYEDADAVHLVMELCDGGELFDRIVARGRYTERAAAAAARTVAEVVRACHA HGVMHRDLKPENFLYAGKAEDAQLKAIDFGLSVFFRPGERFREIVGSPYYMAPEVLRR DYGPEVDIWSAGVILYILLCGVPPFWAETEQGVARAILRGAADFDREPWPRISRAAKS LVRQMLDVDPRRRPTAQQVLDHPWLHHAARAPNVPLGDVVRARLKQFSLMNRLKKKAM RVIAEHLSVEEVEVIKDMFALMDTDNNGRVTLQELKDGLTKVGSKLAEPEMELLMEAA DVDGNGYLDYGEFVAVTIHLQRLSNDNHLRTAFLFFDKDGSGYIDRAELADALADDSG HADDAVLDHILREVDTDKDGRISYEEFVAMMKSGTDWRKASRQYSRERFKTLSNSLIK DGSITMAR</aaseq>

Gene Sequence

<dnaseqindica>139..904#3646..4058#4146..4313#4383..4613#4890..5036#atgcttcttgttcatccaagctaagctgagctgagctgagatgggcgagagatgtagaagtagatagaattaagctagctagagaggtagatatatagctgtggtgaggaagtttccagaaggttctagaagatcgccatgggcaacacgtgctgcgtcgctccggctaccaccgatgaggtgggcgcgccgccgcgagatcatcatcacgcggccaagaagtcgccggcgccgtcggcgacgacgacgacggcgacgaggcagaggcatggccaagaacccaagcccaagcccaagcccagggcgagggcgaagcccaacccgtacgactgggcgccgccgcgggtgctgccggcgaggggcggcgccgccgcgtccgcggtgcgcgtgctggagggcgtggtgccgcaccacccgcggctgcgcgtcacggacaagtaccagctcggccgcgagctggggcgcggcgagttcggggtgacgcacctcgccacggaccgcgcgacgcgggagcggctggcgtgcaagtccatcccgaagcgccgcctccgcaccgccgtggacgtcgccgacgtgcggcgcgaggtggccatcatggcgtcgctcccggaccacccggcgctggtgcgcctccgcgccgcctacgaggacgccgacgcggtgcacctggtgatggagctctgcgacggcggcgagctgttcgaccggatcgtggcgaggggccggtacacggagcgcgccgcggccgccgcggcgcggacggtggcggaggtggtgcgcgcgtgccacgcccacggcgtgatgcaccgcgacctcaagccggagaacttcctctacgccggcaaggccgaggacgcgcagctcaaggccatcgatttcggcctctccgtcttcttccgacctggtcagcttcttcccttcttcttcctctgcaatgcatgcacgcttgaacaaaacttttttttttttgcctctcttccccatttaatttttttagaacatattctcaaaattttttagtggtagtagatattctcaaaaatcccattcaaagaatttttttagagattttcagtacctcaaaaaatcccattgcaagaaattttggagattttcactatatgaaaaattgatctgcaaataaatttggagcttttcacaataatttttcacaatctcaaagattgaaatgtaaataaattgggagctttttcaaaatatcaaagatgaaattgcaaaaaaaagaggatattttttccttcacaatgtcaaaagatctaattgcatgaaaacagagattttccagaaatgctcaaactagttttgcagttgtttttttgggttgcacgtggattctttgagaattataatactataagcacagttgggaatagttaattagtcccctgctacaacttttcaaaagatcccttctgttataaaaggtgaaattttatcccatttcttaaacacgttatcttttcacgggtgccaaatcataaagcacaaaacacccccaaatgatcaatgggtaggtgggagtacatataaaacctcagtagagccttttatgtttttatatatgaaaaacatatctttaagagaaattttatggtacttaaaagaggtgctctctccaatcatttgtacttgacgttggaagaaccaatcgtaattctgttaacgtcaaatataaatgaaccgcgagggagggagaatcaaattttgcagagagagataccgaaaatacgatgcctcataaaaaaccgcaaaatcactcgtattaaaaaagaatcataaacatcaataagaacacattatttctaacaaaatgtgaacccatagttggtcggctaaccaacccaaatttgaccccctcccttagtaaatttggtgtgcagtgaaaatagaacaggtcggcgtttcggtgccctcttgcgcctgaatttcactttcaccggtggaagaaattaagaacagtctgcatttgaaatggcagctgatcgtgacggtgagccgaaaaaccgagccaattctgcccgaaattttcagagaaaaagtctgtggatgctgggtcatcagatgatgctactcctctctgcagacacgcatcacgccgtcccctgtgtttagcttactcggtcagtgagttcgtcaacctaccacaaagctgaatttcttttttaattaacgatagtagaaaagaatataaaagtataacctgaatatttttattttgaaaaaaaatggattggaaaaccatgtgtttatatctagaccgaatatacgcagccacgaaaaacagtgattaaaaaagagaacaaaatcaccaccacacgccgagttttttttttccatagttgcgtccagactgttaagaggtcgtggtcggcagcagattgctgtcaagatcttaattaagataagcaagatcggtgtcaaggatcttacgataatagacgactcgctcttgttgagtcctcaggggagaaaaaaactgtcactcttgttcttaattattgttcctctttgatgttgcatggccgaatagattgagctggacagatcatttcagaatacagtcaactcgtaccgttattgcttggaatgtaagaatggtggtaaaacatatgaatagcaaataagcagagttttaatataaatacatttgcataacaaaggatccgtataataaaagaagtacaagaattggatcagagagacgggggttgttttaaccttactccaaaatattaatgcattgagcagtccaaaggaatttcatgagatttttagatctccaatcctttcctcaaataaatggaaagatttgaattctacaaaactccttgacaagtcctttgttataaacagaggctctccattttgcacattcatgttcaagcaaaaaaaaaagacattttgcacattgacatgatctttcaaacataatattgaccatcactttgcatcataatatatacagtgataaaattccagtgtattttgcttatccatcttgaacgtttaaaatggatttttatttataccttaagtctaaatgcatatctaaagcatcaaaatatggggttaagtatacatttgtggataaatttgtactaaccacagtacaatatttgtgacgagatagagcctagtgagagtgtgactctgagatgggccggcctacatgcaatctgtgcagataggcccagtagatttcatacggcccatgtttcaaatccagccttttcttcaacctcaccaaaaaactagttatacatttgttgtcaaagatgtaattatagcacaattgtgttgtaactatattataatttagtatcatgtaacttgtaagtaactttcaaaaatcaataggcgacatgttatttccatgaaatggaggtaatggaaccgaattcccttacatgcgtgtgcaatgtgattttttcttatctaccttgcatgaattttaaagcaaaatcgaacggtttaaaagtatgtgaaagttacgtacaaattacattatagttacatgtgtgattacacatatttacatttgttaaatttttatgagaaaatttgccgataaatatacagaaaaaaaagagaaaaaaaactgacttggcaagtgaaaggaaacaggggagaggttcagggagatcgtggggagcccgtactacatggcgccggaggtgctccggcgagactacggcccggaggtggacatctggtccgccggcgtcatcctctacatcctcctgtgcggcgtcccgccgttctgggccgagacggagcagggcgtggcgcgcgccatcctccgcggcgccgccgacttcgaccgggagccatggccgcgcatctcccgcgccgccaagtccctcgtccgccagatgctcgacgtggacccgcgccgccgccccacggcgcagcaggtgctcgaccacccctggctccaccacgccgcccgcgcccccaacgtccccctcggcgacgtcgtccgcgcccgcctcaagcagttctccctcatgaaccgcctcaagaagaaggccatgcgggtacgtggcgtgcgtgctctgctcttgatgtcgtctccggcgacggcgagcccgtttctgtgtctgaccgcccagcgatgcacgcaggtgatcgcggaacacctgtcggtagaggaggtggaggtgatcaaggacatgttcgcgctcatggacaccgacaacaacggcagggtcacgctccaggagctcaaggacggcctcaccaaggtcggctccaagctcgccgagcccgagatggagcttctcatggaggccgtaagcttctttacccttcttcaagatagcaatggcggcaatggcgagttcttgattttgcattggcaggcggatgtggatggcaatgggtacctggactacggcgagttcgtggcggtgaccatccacctgcagcgcctctccaacgacaaccacctccgcacggccttcctcttcttcgacaaggacggcagcggctacatcgaccgcgccgagctcgccgacgccctcgccgacgactccggccacgccgacgacgccgtgctcgaccacatccttagagaagtcgacaccgacaaggtaaacacacacgcttcccttccactactccatttgcaacaaaaatgttcttcaattcagctctatctcttttgaagcctagccagatagtttgaactccactcagaattagagtgaaattagttgaagcgctcttacaaaatgaactggagaaatgtaactgggtttagcctcctccacaactccacttcaaactcggctctcggagttaaatttaggcgttagagctctcccaaataaactctgaaactgatcaatctctgaatttgcatgcaggatgggcggatcagctacgaggagttcgtggcgatgatgaaatccgggacggattggaggaaggcgtcgcggcaatactcgagggagcggttcaagacgctcagcaacagcctcatcaaggacggctcgatcaccatggcgcgctagctagctcgacgaattcagtcgattcaggcttgagaattcattgagaatatgaggtcgatgcaatgctcgaattttttttttttgatgcatacttcattcgaatttgaatttgggttttccatttcgtccaatttttcttttgtacaatctactgtagatcgatcggtcgtctatctgaaccttctttgtgtaggatgtgttagtgaacgctgggattgtttcagcattcgttgtacgtgtttgaaattgcgtcgggtgtaattatgtggtaacggtggtaatcaagcaaatttacagc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0688300, RefSeq:Os03g0688300

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 2.2 2.3 2.4 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3