Difference between revisions of "Os09g0494200"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 30: Line 30:
 
<ref name="ref2">Rao Y C, et al. Characterization and cloning of a brittle culm  mutant (bc88 ) in rice ( Oryza sativa L.)[J]. Chin Sci Bull, 2013, 58:  
 
<ref name="ref2">Rao Y C, et al. Characterization and cloning of a brittle culm  mutant (bc88 ) in rice ( Oryza sativa L.)[J]. Chin Sci Bull, 2013, 58:  
 
3000-3006.
 
3000-3006.
<references>
+
</references>
 +
 
 
==Structured Information==
 
==Structured Information==
 
{{JaponicaGene|
 
{{JaponicaGene|

Revision as of 13:30, 3 June 2014

Please input one-sentence summary here.

Annotated Information

Function

The rice Os09g0494200 was reported as Brittle Culm15 (BC15) which encodes a membrane-associated chitinase-like protein required for cellulose biosynthesis in rice. Plant chitinases, a class of glycosyl hydrolases, participate in various aspects of normal plant growth and development, including cell wall metabolism and disease resistance. BC15 was designated as Chitinase-Like Protein1(OsCTL1) and will henceforth be referred to as BC15/OsCTL1.


BC15/OsCTL1 is an N-glycosylated membrane protein. Mutation of BC15/OsCTL1 causes reduced cellulose content and mechanical strength without obvious alterations in plant growth, showed in Figure 1. Biochemical assays demonstrated that BC15/OsCTL1 is a Golgi-localized type II membrane protein that lacks classical chitinase activity. Investigation of the global expression profile of wild-type and bc15 plants, using Illumina RNA sequencing, further suggested a possible mechanism by which BC15/OsCTL1 mediates cellulose biosynthesis and cell wall remodeling. And it is localized in the Golgi apparatus with its C-terminus facing the Golgi lumen. [1]

One.jpg

Expression

To date, at least 12 bc mutants (bc1, bc2, bc3, bc4, bc5, bc6, bc7, bc10, bc11, bc12, bc14 and bc15) have been characterized in rice. BC15 encodes a membrane-associated chitinase-like protein.[2] Quantitative real-time polymerase chain reaction and β-glucuronidase activity analyses indicated that BC15/OsCTL1 is ubiquitously expressed. BC15/OsCTL1 is ubiquitously expressed in many organs. The expression pattern of BC15/OsCTL1 was analyzed by quantitative real-time (qRT)-PCR using RNAs isolated from various organs from wild-type plants. As shown in Figure 2A, BC15/OsCTL1 is expressed in several organs, with relatively high levels in the internodes and nodes. This expression pattern fits with the brittle culm phenotype of bc15.


To further examine its expression at the tissue level, the promoter of BC15/OsCTL1 was fused to the GUS reporter gene and the construct was expressed in the wild-type plants. We detected GUS activity in the coleoptiles, roots, shoots, and lamina joints of transgenic seedlings (Fig. 2, B–E). Careful observation revealed stronger GUS-derived signal in the elongation zone of the roots than in the root tips (Fig. 2C) and strong GUS-derived signal in the vascular bundles of the root mature zone (Fig. 2D). GUS activity was also observed in the panicle branches and glumes of mature plants (Fig. 2F). Fresh hand-cut sectioning of the stained internodes clearly showed strong GUS activity in the vascular bundles (Fig. 2G).Therefore, BC15/OsCTL1 is ubiquitously expressed, especially in the tissues that confer mechanical strength in fully developed rice plants.

Two.jpg

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2

Structured Information

Gene Name

Os09g0494200

Description

Similar to Chitinase-like protein (EC 3.2.1.14)

Version

NM_001070084.1 GI:115479910 GeneID:4347451

Length

1807 bp

Definition

Oryza sativa Japonica Group Os09g0494200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:19801754..19803560

Sequence Coding Region

19802078..19802480,19802568..19802724,19802797..19803217

Expression

GEO Profiles:Os09g0494200

Genome Context

<gbrowseImage1> name=NC_008402:19801754..19803560 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:19801754..19803560 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaagaggaagactcggaacaagataatcctgacgacgctgctggtgtcggcggcggcgatcctgatcggcgggacggtggcgctgatcctgacggcggggacatggaaggtgaagatgaaggagtcgcgcgagaagatctgcgacaaggggtgggagtgctcgggtagcaagtactgctgcaacgacaccatcaccgacttcttcaaggtgtaccagttcgagaacctcttctccaagcgcaacagccccgtcgcccacgccgtcggcttctgggactaccagtccttcatcaccgccgccgccctcttcgagcccctcggcttctgcaccaccggcggcaagcagatgcagatgatggagctctgcgccttcctcggccatgtcggctccaagacctcatgtggatttggtgtggcgaccggcgggccgacggcgtgggggctctgctacaaccacgagatgagccctaaggaggattactgcgacaagacgaacctgcagtatccctgcgtcgagggcgccgagtactacggccgcggcgccatccccgtcttctggaactacaactatggcgcggcgggcgacgggatacacgaggacctgctccaccacccggagtacctggagcagaacgcgacgatggcgttcatggcggcgatgtggcggtggatgacgccgatgaagaagaagcagccgtcggcgcacgacgtgttcgtgggcaactggaagcccaccaagaacgacacgctcgccaagcgcctccccgggttcggcgccaccatgaacgtgctctacggcgaccagatctgcggcaagggctacatcgacgacatgaacgtcatcatctcgcactaccagtactacctcgacctcatgggcgtcggccgcgagcactccggcgacaaccgcgactgcgccgagcaggccgccttcaacccctcctacaagaagcccgacgatcagcagcaacaaagctag</cdnaseq>

Protein Sequence

<aaseq>MKRKTRNKIILTTLLVSAAAILIGGTVALILTAGTWKVKMKESR EKICDKGWECSGSKYCCNDTITDFFKVYQFENLFSKRNSPVAHAVGFWDYQSFITAAA LFEPLGFCTTGGKQMQMMELCAFLGHVGSKTSCGFGVATGGPTAWGLCYNHEMSPKED YCDKTNLQYPCVEGAEYYGRGAIPVFWNYNYGAAGDGIHEDLLHHPEYLEQNATMAFM AAMWRWMTPMKKKQPSAHDVFVGNWKPTKNDTLAKRLPGFGATMNVLYGDQICGKGYI DDMNVIISHYQYYLDLMGVGREHSGDNRDCAEQAAFNPSYKKPDDQQQQS</aaseq>

Gene Sequence

<dnaseqindica>325..727#815..971#1044..1464#acacacaacggcaacgtcttaccagctcggagctctctcgcttgctgcctcttctcttcttcctcccgccaccgacaccacctccaccagcagcttcgccttcgccgcgtcggcatctgcagttgccacttcgctttcttccactccctcctcctcctcgcttacctcacactcctcccccccaatttcatcccccacccaccaccagatcccccaccacctgccgcattctcccccccaagatccagatcgccggtcacccccacgaactcgctcgagatccagagagagagagagaggcagtttcttggttgattttcgaggatgaagaggaagactcggaacaagataatcctgacgacgctgctggtgtcggcggcggcgatcctgatcggcgggacggtggcgctgatcctgacggcggggacatggaaggtgaagatgaaggagtcgcgcgagaagatctgcgacaaggggtgggagtgctcgggtagcaagtactgctgcaacgacaccatcaccgacttcttcaaggtgtaccagttcgagaacctcttctccaagcgcaacagccccgtcgcccacgccgtcggcttctgggactaccagtccttcatcaccgccgccgccctcttcgagcccctcggcttctgcaccaccggcggcaagcagatgcagatgatggagctctgcgccttcctcggccatgtcggctccaagacctcatgtgtgtagcttcttcgttttcgctatggtttgatttggatttgaggttttaagctcgccattgatggggatttgtgtgtgtgtgcaggtggatttggtgtggcgaccggcgggccgacggcgtgggggctctgctacaaccacgagatgagccctaaggaggattactgcgacaagacgaacctgcagtatccctgcgtcgagggcgccgagtactacggccgcggcgccatccccgtcttctggtaagcttcgcttcgtcgccgccatctcgatcgcttgatttgatgattgattcggattcggattcggaataggaactacaactatggcgcggcgggcgacgggatacacgaggacctgctccaccacccggagtacctggagcagaacgcgacgatggcgttcatggcggcgatgtggcggtggatgacgccgatgaagaagaagcagccgtcggcgcacgacgtgttcgtgggcaactggaagcccaccaagaacgacacgctcgccaagcgcctccccgggttcggcgccaccatgaacgtgctctacggcgaccagatctgcggcaagggctacatcgacgacatgaacgtcatcatctcgcactaccagtactacctcgacctcatgggcgtcggccgcgagcactccggcgacaaccgcgactgcgccgagcaggccgccttcaacccctcctacaagaagcccgacgatcagcagcaacaaagctagaacagatcacccccaattccccccaattccacggtaaagaattcacccaatgtgttgttgtatacatcttcttgctactgcaatcgctattgccaatgcaaaccaaccattgccattgctgttgcctcgtgagctatacagattaacggattcttcatcagtgtgaggagctgtggtttgcattggtgtatttctgagtagcggattttgagggaagtgtcaactgtgtgtgtgatgcctatgggatttgggaaatttgttgtagcccttgttgtaccatagtgtacattttcattccatttgatttttgtcacatatacatgtttaaagaggaggattcagg</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0494200, RefSeq:Os09g0494200