Difference between revisions of "Os03g0766100"
Littlescrew (talk | contribs) (→Annotated Information) |
Littlescrew (talk | contribs) (→Annotated Information) |
||
| Line 2: | Line 2: | ||
==Annotated Information== | ==Annotated Information== | ||
| + | CysR10 is essential for formation of the tightly compact, spherical shaped structure of PB-I. | ||
===Function=== | ===Function=== | ||
Please input function information here. | Please input function information here. | ||
| Line 12: | Line 13: | ||
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
| − | |||
==Labs working on this gene== | ==Labs working on this gene== | ||
Revision as of 04:58, 4 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
CysR10 is essential for formation of the tightly compact, spherical shaped structure of PB-I.
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os03g0766100 |
|---|---|
| Description |
10 kDa prolamin precursor |
| Version |
NM_001057915.1 GI:115455558 GeneID:4334227 |
| Length |
574 bp |
| Definition |
Oryza sativa Japonica Group Os03g0766100, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:32580334..32580907 |
| Sequence Coding Region |
32580436..32580840 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:32580334..32580907 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:32580334..32580907 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcagcatacaccagcaagatctttgccctgtttgccttaattgctctttctgcaagtgccactactgcaatcaccactatgcagtatttcccaccaacattagccatgggcaccatggatccgtgtaggcagtacatgatgcaaacgttgggcatgggtagctccacagccatgttcatgtcgcagccaatggcgctcctgcagcagcaatgttgcatgcagctacaaggcatgatgcctcagtgccactgtggcaccagttgccagatgatgcagagcatgcaacaagttatttgtgctggactcgggcagcagcagatgatgaagatggcgatgcagatgccatacatgtgcaacatggcccctgtcaacttccaactctcttcctgtggttgttgttga</cdnaseq> |
| Protein Sequence |
<aaseq>MAAYTSKIFALFALIALSASATTAITTMQYFPPTLAMGTMDPCR QYMMQTLGMGSSTAMFMSQPMALLQQQCCMQLQGMMPQCHCGTSCQMMQSMQQVICAG LGQQQMMKMAMQMPYMCNMAPVNFQLSSCGCC</aaseq> |
| Gene Sequence |
<dnaseqindica>68..472#atcatcctcaacaatattgtctacaccatctggaatcttgtttaacactagtattgtagaatcagcaatggcagcatacaccagcaagatctttgccctgtttgccttaattgctctttctgcaagtgccactactgcaatcaccactatgcagtatttcccaccaacattagccatgggcaccatggatccgtgtaggcagtacatgatgcaaacgttgggcatgggtagctccacagccatgttcatgtcgcagccaatggcgctcctgcagcagcaatgttgcatgcagctacaaggcatgatgcctcagtgccactgtggcaccagttgccagatgatgcagagcatgcaacaagttatttgtgctggactcgggcagcagcagatgatgaagatggcgatgcagatgccatacatgtgcaacatggcccctgtcaacttccaactctcttcctgtggttgttgttgatcaaacgttggttacatgtactctagtaataaggtgttgcatactatcgtgtgcaaacactagaaataagaaccattgaataaaatatcaatcattttcaga</dnaseqindica> |
| External Link(s) |