Difference between revisions of "Os03g0766100"
Littlescrew (talk | contribs) (→Function) |
Littlescrew (talk | contribs) (→Function) |
||
| Line 5: | Line 5: | ||
===Function=== | ===Function=== | ||
| − | Sulfur-rich prolamin gene CysR10 | + | Sulfur-rich prolamin gene ''CysR10'' locates in chromosome 3, and encodes Cysteine-Rich 10 kDa Prolamin. RP10 <ref name="ref1" />, ''CysR10'' <ref name="ref2" />, and ''crP10'' <ref name="ref3" /> represent the same gene. The rice prolamins consist of 60% Cys-rich prolamins and 40% Cys-poor prolamins, and the 10, 14 and 16 kDa prolamins are Cys-rich species, while the 13 kDa prolamin is a Cys-poor species <ref name="ref4" />. The 10 kDa prolamins (CysR10) share minimal sequence homology with the other two classes and are characterized by their high content of methionine (20%) and cysteine (10%) residues <ref name="ref5" />. In rice, there are two types of protein bodies (PBs), called PB-I in which prolamins are accumulated as intracisternal protein granules and PB-II. These prolamin species are asymmetrically distributed within PB-I and that CysR10 is essential for formation of the tightly compact, spherical shaped structure of PB-I <ref name="ref2" />. |
===Expression=== | ===Expression=== | ||
Revision as of 05:08, 4 June 2014
Please input one-sentence summary here.
CysR10 is essential for formation of the tightly compact, spherical shaped structure of PB-I.
Contents
Annotated Information
Function
Sulfur-rich prolamin gene CysR10 locates in chromosome 3, and encodes Cysteine-Rich 10 kDa Prolamin. RP10 [1], CysR10 [2], and crP10 [3] represent the same gene. The rice prolamins consist of 60% Cys-rich prolamins and 40% Cys-poor prolamins, and the 10, 14 and 16 kDa prolamins are Cys-rich species, while the 13 kDa prolamin is a Cys-poor species [4]. The 10 kDa prolamins (CysR10) share minimal sequence homology with the other two classes and are characterized by their high content of methionine (20%) and cysteine (10%) residues [5]. In rice, there are two types of protein bodies (PBs), called PB-I in which prolamins are accumulated as intracisternal protein granules and PB-II. These prolamin species are asymmetrically distributed within PB-I and that CysR10 is essential for formation of the tightly compact, spherical shaped structure of PB-I [2].
Expression
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os03g0766100 |
|---|---|
| Description |
10 kDa prolamin precursor |
| Version |
NM_001057915.1 GI:115455558 GeneID:4334227 |
| Length |
574 bp |
| Definition |
Oryza sativa Japonica Group Os03g0766100, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:32580334..32580907 |
| Sequence Coding Region |
32580436..32580840 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:32580334..32580907 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:32580334..32580907 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcagcatacaccagcaagatctttgccctgtttgccttaattgctctttctgcaagtgccactactgcaatcaccactatgcagtatttcccaccaacattagccatgggcaccatggatccgtgtaggcagtacatgatgcaaacgttgggcatgggtagctccacagccatgttcatgtcgcagccaatggcgctcctgcagcagcaatgttgcatgcagctacaaggcatgatgcctcagtgccactgtggcaccagttgccagatgatgcagagcatgcaacaagttatttgtgctggactcgggcagcagcagatgatgaagatggcgatgcagatgccatacatgtgcaacatggcccctgtcaacttccaactctcttcctgtggttgttgttga</cdnaseq> |
| Protein Sequence |
<aaseq>MAAYTSKIFALFALIALSASATTAITTMQYFPPTLAMGTMDPCR QYMMQTLGMGSSTAMFMSQPMALLQQQCCMQLQGMMPQCHCGTSCQMMQSMQQVICAG LGQQQMMKMAMQMPYMCNMAPVNFQLSSCGCC</aaseq> |
| Gene Sequence |
<dnaseqindica>68..472#atcatcctcaacaatattgtctacaccatctggaatcttgtttaacactagtattgtagaatcagcaatggcagcatacaccagcaagatctttgccctgtttgccttaattgctctttctgcaagtgccactactgcaatcaccactatgcagtatttcccaccaacattagccatgggcaccatggatccgtgtaggcagtacatgatgcaaacgttgggcatgggtagctccacagccatgttcatgtcgcagccaatggcgctcctgcagcagcaatgttgcatgcagctacaaggcatgatgcctcagtgccactgtggcaccagttgccagatgatgcagagcatgcaacaagttatttgtgctggactcgggcagcagcagatgatgaagatggcgatgcagatgccatacatgtgcaacatggcccctgtcaacttccaactctcttcctgtggttgttgttgatcaaacgttggttacatgtactctagtaataaggtgttgcatactatcgtgtgcaaacactagaaataagaaccattgaataaaatatcaatcattttcaga</dnaseqindica> |
| External Link(s) |
- ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref1 - ↑ 2.0 2.1 Cite error: Invalid
<ref>tag; no text was provided for refs namedref2 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref3 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref4 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref5