Difference between revisions of "Os03g0766100"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 5: Line 5:
  
 
===Function===
 
===Function===
Sulfur-rich prolamin gene CysR10 located in chromosome 3, and encodes Cysteine-Rich 10 kDa Prolamin. RP10 <ref name="ref1" />, CysR10 <ref name="ref2" />, and crP10 <ref name="ref3" /> represent the same gene.  The rice prolamins consist of 60% Cys-rich prolamins and 40% Cys-poor prolamins, and the 10, 14 and 16 kDa prolamins are Cys-rich species, while the 13 kDa prolamin is a Cys-poor species <ref name="ref4" />. The 10 kDa prolamins (CysR10) share minimal sequence homology with the other two classes and are characterized by their high content of methionine (20%) and cysteine (10%) residues <ref name="ref5" />. In rice, there are two types of protein bodies (PBs), called PB-I in which prolamins are accumulated as intracisternal protein granules and PB-II. These prolamin species are asymmetrically distributed within PB-I and that CysR10 is essential for formation of the tightly compact, spherical shaped structure of PB-I <ref name="ref2" />.
+
Sulfur-rich prolamin gene ''CysR10'' locates in chromosome 3, and encodes Cysteine-Rich 10 kDa Prolamin. RP10 <ref name="ref1" />, ''CysR10'' <ref name="ref2" />, and ''crP10'' <ref name="ref3" /> represent the same gene.  The rice prolamins consist of 60% Cys-rich prolamins and 40% Cys-poor prolamins, and the 10, 14 and 16 kDa prolamins are Cys-rich species, while the 13 kDa prolamin is a Cys-poor species <ref name="ref4" />. The 10 kDa prolamins (CysR10) share minimal sequence homology with the other two classes and are characterized by their high content of methionine (20%) and cysteine (10%) residues <ref name="ref5" />. In rice, there are two types of protein bodies (PBs), called PB-I in which prolamins are accumulated as intracisternal protein granules and PB-II. These prolamin species are asymmetrically distributed within PB-I and that CysR10 is essential for formation of the tightly compact, spherical shaped structure of PB-I <ref name="ref2" />.
  
 
===Expression===
 
===Expression===

Revision as of 05:08, 4 June 2014

Please input one-sentence summary here.

CysR10 is essential for formation of the tightly compact, spherical shaped structure of PB-I.

Annotated Information

Function

Sulfur-rich prolamin gene CysR10 locates in chromosome 3, and encodes Cysteine-Rich 10 kDa Prolamin. RP10 [1], CysR10 [2], and crP10 [3] represent the same gene. The rice prolamins consist of 60% Cys-rich prolamins and 40% Cys-poor prolamins, and the 10, 14 and 16 kDa prolamins are Cys-rich species, while the 13 kDa prolamin is a Cys-poor species [4]. The 10 kDa prolamins (CysR10) share minimal sequence homology with the other two classes and are characterized by their high content of methionine (20%) and cysteine (10%) residues [5]. In rice, there are two types of protein bodies (PBs), called PB-I in which prolamins are accumulated as intracisternal protein granules and PB-II. These prolamin species are asymmetrically distributed within PB-I and that CysR10 is essential for formation of the tightly compact, spherical shaped structure of PB-I [2].

Expression

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os03g0766100

Description

10 kDa prolamin precursor

Version

NM_001057915.1 GI:115455558 GeneID:4334227

Length

574 bp

Definition

Oryza sativa Japonica Group Os03g0766100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:32580334..32580907

Sequence Coding Region

32580436..32580840

Expression

GEO Profiles:Os03g0766100

Genome Context

<gbrowseImage1> name=NC_008396:32580334..32580907 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:32580334..32580907 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcagcatacaccagcaagatctttgccctgtttgccttaattgctctttctgcaagtgccactactgcaatcaccactatgcagtatttcccaccaacattagccatgggcaccatggatccgtgtaggcagtacatgatgcaaacgttgggcatgggtagctccacagccatgttcatgtcgcagccaatggcgctcctgcagcagcaatgttgcatgcagctacaaggcatgatgcctcagtgccactgtggcaccagttgccagatgatgcagagcatgcaacaagttatttgtgctggactcgggcagcagcagatgatgaagatggcgatgcagatgccatacatgtgcaacatggcccctgtcaacttccaactctcttcctgtggttgttgttga</cdnaseq>

Protein Sequence

<aaseq>MAAYTSKIFALFALIALSASATTAITTMQYFPPTLAMGTMDPCR QYMMQTLGMGSSTAMFMSQPMALLQQQCCMQLQGMMPQCHCGTSCQMMQSMQQVICAG LGQQQMMKMAMQMPYMCNMAPVNFQLSSCGCC</aaseq>

Gene Sequence

<dnaseqindica>68..472#atcatcctcaacaatattgtctacaccatctggaatcttgtttaacactagtattgtagaatcagcaatggcagcatacaccagcaagatctttgccctgtttgccttaattgctctttctgcaagtgccactactgcaatcaccactatgcagtatttcccaccaacattagccatgggcaccatggatccgtgtaggcagtacatgatgcaaacgttgggcatgggtagctccacagccatgttcatgtcgcagccaatggcgctcctgcagcagcaatgttgcatgcagctacaaggcatgatgcctcagtgccactgtggcaccagttgccagatgatgcagagcatgcaacaagttatttgtgctggactcgggcagcagcagatgatgaagatggcgatgcagatgccatacatgtgcaacatggcccctgtcaacttccaactctcttcctgtggttgttgttgatcaaacgttggttacatgtactctagtaataaggtgttgcatactatcgtgtgcaaacactagaaataagaaccattgaataaaatatcaatcattttcaga</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0766100, RefSeq:Os03g0766100

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  5. Cite error: Invalid <ref> tag; no text was provided for refs named ref5